Recombinant Mouse TIMP1 Protein
Beta LifeScience
SKU/CAT #: BLA-10131P
Recombinant Mouse TIMP1 Protein
Beta LifeScience
SKU/CAT #: BLA-10131P
Catalog No.: BLA-10131P
Product Overview
| Host Species | Mouse |
| Accession | P12032 |
| Synonym | Clgi Collagenase inhibitor Collagenase inhibitor, Human EPA EPO Erythroid Potentiating Activity Erythroid-potentiating activity Fibroblast collagenase inhibitor FLJ90373 HCI Human Collagenase Inhibitor Metalloproteinase inhibitor 1 Metalloproteinase inhibitor 1 precursor OTTHUMP00000023214 TIMP TIMP 1 TIMP metallopeptidase inhibitor 1 TIMP-1 Timp1 TIMP1 protein TIMP1_HUMAN Tissue Inhibitor of Metalloproteinase 1 Tissue inhibitor of metalloproteinases Tissue inhibitor of metalloproteinases 1 Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor |
| Description | Recombinant Mouse TIMP1 Protein was expressed in Insect cells. It is a Full length protein |
| Source | Insect cells |
| AA Sequence | CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFK AVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACS FLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQ VLVGSEDYQSRHFACLPRNPGLCTWRSLGARHHHHHH |
| Molecular Weight | 21 kDa including tags |
| Purity | >95% purity as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
