Recombinant Mouse TIM 4 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10129P
Recombinant Mouse TIM 4 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10129P
Catalog No.: BLA-10129P
Product Overview
| Host Species | Mouse |
| Accession | Q6U7R4 |
| Synonym | SMUCKLER Spleen, mucin-containing, knockout of lymphotoxin protein T cell immunoglobulin and mucin domain containing protein 4 T-cell immunoglobulin and mucin domain containing 4 T-cell immunoglobulin and mucin domain containing molecule T-cell immunoglobulin and mucin domain-containing protein 4 T-cell immunoglobulin and mucin domains-containing protein 4 T-cell membrane protein 4 TIM-4 Tim4 TIMD 4 TIMD-4 Timd4 TIMD4_HUMAN |
| Description | Recombinant Mouse TIM 4 Protein (Fc Tag Active) was expressed in CHO cells. It is a Protein fragment |
| Source | CHO cells |
| AA Sequence | AASEDTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRT DGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFN DVKKNVRLELRRATTTKKPTTTTRPTTTPYVTTTTPELLPTTVMTTSVLP TTTPPQTLATTAFSTAVTTCPSTTPGSFSQETTKGSAFTTESETLPASNH SQRSMMTISTDIAVLRPTGSNPGILPSTSQLTTQKTTLTTSESLQKTTKS HQINSRQT |
| Molecular Weight | 28 kDa |
| Purity | >= 98% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated Human T cells. |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |
