Recombinant Mouse Tim 2 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10128P

Recombinant Mouse Tim 2 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10128P
Catalog No.: BLA-10128P
Product Overview
Host Species | Mouse |
Accession | Q8R183 |
Synonym | AA816106 AU019358 AU019662 C78111 G9D3 T cell immunoglobulin and mucin domain containing 2 T cell immunoglobulin and mucin domain containing 2 protein T-cell immunoglobulin mucin receptor 2 T-cell membrane protein 2 Tim2 Timd2 |
Description | Recombinant Mouse Tim 2 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | HTAVQGLAGHPVTLPCIYSTHLGGIVPMCWGLGECRHSYCIRSLIWTNGY TVTHQRNSLYQLKGNISEGNVSLTIENTVVGDGGPYCCVVEIPGAFHFVD YMLEVKPEISTSPPTRPTATGRPTTISTRSTHVPTSTRVSTSTSPTPAHT ETYKPEATTFYPDQTTAEVTETLPDTPADWHNTVTSSDDPWDDNTEVIPP QKPQKNLN |
Molecular Weight | 65 kDa including tags |
Purity | >98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |