Recombinant Mouse TIM 1 Protein
Beta LifeScience
SKU/CAT #: BLA-10126P
Recombinant Mouse TIM 1 Protein
Beta LifeScience
SKU/CAT #: BLA-10126P
Catalog No.: BLA-10126P
Product Overview
| Host Species | Mouse |
| Accession | Q5QNS5 |
| Synonym | CD365 HAVCR HAVCR 1 HAVcr-1 Havcr1 Hepatitis A virus cellular receptor 1 Kidney injury molecule 1 KIM 1 KIM-1 T cell immunoglobin domain and mucin domain protein 1 T cell immunoglobulin mucin family member 1 T cell immunoglobulin mucin receptor 1 T-cell immunoglobulin and mucin domain-containing protein 1 T-cell membrane protein 1 TIM TIM-1 TIM1 TIMD 1 TIMD-1 TIMD1 TIMD1_HUMAN |
| Description | Recombinant Mouse TIM 1 Protein was expressed in Insect cells. It is a Protein fragment |
| Source | Insect cells |
| AA Sequence | YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHR VTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKV TFSLQVKPEIPTRPPTRPTTTRPTATGRPTTISTRSTHVPTSIRVSTSTP PTSTHTWTHKPEPTTFCPHETTAEVTGIPSHTPTDWNGTVTSSGDTWSNH TEAIPPGKPQKNPTKGHHHHHH |
| Molecular Weight | 24 kDa including tags |
| Purity | >90% purity as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
