Recombinant Mouse TIM 1 Protein

Name: Recombinant Mouse TIM 1 Protein
Brand: Beta LifeScience
SKU: BLA-10126P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	Q5QNS5
Synonym	CD365 HAVCR HAVCR 1 HAVcr-1 Havcr1 Hepatitis A virus cellular receptor 1 Kidney injury molecule 1 KIM 1 KIM-1 T cell immunoglobin domain and mucin domain protein 1 T cell immunoglobulin mucin family member 1 T cell immunoglobulin mucin receptor 1 T-cell immunoglobulin and mucin domain-containing protein 1 T-cell membrane protein 1 TIM TIM-1 TIM1 TIMD 1 TIMD-1 TIMD1 TIMD1_HUMAN
Description	Recombinant Mouse TIM 1 Protein was expressed in Insect cells. It is a Protein fragment
Source	Insect cells
AA Sequence	YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHR VTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKV TFSLQVKPEIPTRPPTRPTTTRPTATGRPTTISTRSTHVPTSIRVSTSTP PTSTHTWTHKPEPTTFCPHETTAEVTGIPSHTPTDWNGTVTSSGDTWSNH TEAIPPGKPQKNPTKGHHHHHH
Molecular Weight	24 kDa including tags
Purity	>90% purity as determined by SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily, TIM family
Database References	KEGG: mmu:171283 STRING: 10090.ENSMUSP00000043827 UniGene: Mm.17771
Tissue Specificity	Expressed by stimulated T-cells. Expressed during primary antigen stimulation.

Gene Functions References

findings show that TIM1 is not required for hepatitis A virus (HAV) replication and pathogenesis in permissive strains of mice, although it may facilitate early stages of infection by binding phosphatidylserine on the quasi-enveloped HAV surface PMID: 28874468
findings provide evidence for the role of Tim-1 in the induction of a cytokine storm phenomenon and the pathogenesis of Ebola virus disease PMID: 28951472
Cisplatin enhances kidney injury molecule-1 (Kim-1) gene expression in kidney S3 cells. PMID: 27591740
By preventing ERK1/2 phosphorylation following renal injury, STAT3 phosphorylation is decreased, leading to less phosphorylated STAT3 within the nucleus, and subsequently less KIM-1 mRNA increases post injury PMID: 29074644
Study used a previously described highly mobile membrane mimetic membrane in combination with a conventional lipid bilayer model to generate a membrane-bound configuration of Tim1 in silico, identified two possible states for a membrane-bound form of Tim1. PMID: 28978444
Our data reveal a previously unknown role for Galpha12 in regulating efferocytosis and that renal tubular epithelial cells require KIM-1 to mediate this process. PMID: 26697979
Urinary L-FABP, NGAL, Kim-1 and albumin levels increased during the acute phase of kidney injury and were significantly correlated with the degree of tubulointerstitial fibrosis during the chronic phase. These markers could detect higher risk of progression to CKD. PMID: 27028054
Blockade of Tim-1 changes Th1/Th2 balance and reduces circulating regulatory T cells to enhance atherosclerosis in LDL receptor knockout mice. PMID: 26821944
Our results suggest that KIM-1 is an endogenous protective mechanism against renal ischemia-reperfusion injury PMID: 25759266
data suggest that TIM-1 signaling plays a direct role in Breg maintenance and induction both under physiological conditions (in response to ACs) and in response to therapy through TIM-1 ligation PMID: 25645598
Deletion of the mucin domain impaired KIM-1-mediated phagocytic function, resulting in increased proinflammatory cytokine production, decreased antiinflammatory growth factor secretion by proximal epithelial cells, and an increase in tissue macrophages. PMID: 25751064
Tim-1 is critical for maintaining self-tolerance by regulating IL-10 production in Bregs PMID: 25582854
blood biomarker that specifically reflects acute and chronic kidney injury PMID: 24904085
Tim-1 expression was lower in a herpes simplex virus-induced Behcet's disease (BD) mouse model compared to that in asymptomatic BD normal (BDN) mice. PMID: 24453431
Tim-1-Fc protects cardiac grafts from chronic rejection by suppressing CD4 Th17 development and functionality. PMID: 24551271
KIM-1 shedding is accelerated by worsening renal cellular injury, and excess soluble KIM-1 competitively inhibits efferocytosis. PMID: 24829508
Endogenous Tim-1 promotes severe systemic autoimmunity and renal disease MRL-Fas(lpr) mice. PMID: 24623145
a major P-selectin ligand with a role in T cell trafficking during inflammatory responses and the induction of autoimmune disease PMID: 24703780
Sustained KIM-1 expression promotes kidney fibrosis and provides a link between acute and recurrent injury with progressive chronic kidney disease. PMID: 23979159
We defined a novel pathway in which TIM-1, a receptor for phosphatidylserine expressed by apoptotic cells, drives the development of asthma by sensing and responding to injured and apoptotic airway epithelial cells. PMID: 23672783
TIM-1 expressing CD4 T cells are required in the mechanism of innate immune-mediated hepatic IRI in OLTs PMID: 23137033
Tim-1 plays a critical role in maintaining suppressive regulatory B-cell function, while it's mucin domain plays an unexpected role in regulating Breg function and maintaining self-tolerance. PMID: 22773818
Endogenous Tim-1 promotes Th1 and Th17 nephritogenic immune responses and its neutralization reduces renal injury while limiting inflammation in cell-mediated glomerulonephritis. PMID: 22205357
Tim-1 functions in pathways that suppress recruitment of inflammatory cells into the airways and the generation or activity of CD4+ T cells. PMID: 22144095
Tim-1 expression declined in Helicobacter pylori infection. PMID: 21923683
Data show that in vivo in mice, TIM-1 is predominantly expressed on B rather than T cells, and is an inclusive marker for IL-10+ Bregs that can be induced by TIM-1 ligation. PMID: 21821911
Tim1 and Tim3 are not essential for the induction of the type-2 response in lung allergy. PMID: 21470319
mAb stimulation on dendritic cells regulates the balance between effector and regulatory T cells and induces Experimental autoimmune encephalitis PMID: 21469101
The TIM-1:TIM-4 pathway enhances injury after renal ischemia-reperfusion injury and may be a therapeutic target. PMID: 21355054
These results suggest that TIM-1 signaling in B cells augments antibody production by enhancing B cell proliferation and differentiation. PMID: 21303660
results suggest that TIM-1 serves as a pattern recognition receptor on NKT cells that senses PtdSer on apoptotic cells as a damage-associated molecular pattern PMID: 20889552
Tim-1 is induced on germinal centre B cells through BCR signaling. PMID: 20518819
TIM1 is an endogenous ligand for LMIR5. PMID: 20566714
Late upregulation of KIM-1 and NGAL could be a useful marker for sustained renal injury after acute kidney injury. PMID: 20181666
TIM1 costimulation on hepatic natural killer T cells enhances cellular production of interleukin (IL)-4 while inhibiting the production of interferon (IFN)-gamma. PMID: 20220086
TIM-1 regulates not only T for the role of cell activation but may also affect macrophage function in the local inflammation response. PMID: 20091883
protective effects of hepatitis A virus on atopic disease depends on a common TIM-1 allele PMID: 14534576
TIM-1 is a molecule that costimulates T cell activation PMID: 15793575
TIM-1-TIM-4 interaction is involved in regulating T cell proliferation PMID: 15793576
TIM-1 is expressed on CD4+ T cells of the lung-draining lymph nodes after intranasal immunization and plays a role in T cell activation and differentiation. PMID: 16284246
These results explain the divergent immune functions described for the murine receptors and the role of TIM-1 as a cell adhesion receptor in renal regeneration and cancer. PMID: 17363299
The Ig domains of murine TIM1, 3 and 4 display calcium-dependent binding to carbohydrate ligands expressed by murine splenocytes and non-murine cell lines. Both homo- and heterotypic interactions were observed for binding between the TIM proteins. PMID: 17513880
Tim-1 regulates T cell responses and can alter T cell function depending on the affinity/avidity with which it is engaged. PMID: 17606630
In vivo abrogation of TIM-4 or its cognate ligand TIM-1 by using a polyclonal antibody remarkably dampened Th2 differentiation and intestinal allergy. TIM-4 as a novel molecule critically required for the development of intestinal allergy. PMID: 17915221
Ligation of Tim-1 in vitro effectively deprogrammed Tregs and thus produced Tregs unable to control T cell responses. PMID: 18079964
TIM-4 and TIM-1 are immunologically restricted members of the group of receptors whose recognition of PS is critical for the efficient clearance of apoptotic cells and prevention of autoimmunity. PMID: 18082433
These studies define previously unknown functions of TIM-1 in regulating alloimmune responses in vivo . PMID: 18172549
These results demonstrate that TIM-1 is significantly increased in pulmonary tissues and PBMCs in asthmatic mice after ovalbumin challenge, and that the production of TIM-1 as well as GATA-3 is upregulated in the spleen of asthmatic mice. PMID: 18234236
Ligation of Tim-1 in the presence of mature dendritic cells triggers polyclonal T cell activation. PMID: 19155484
Results demonstrate that targeting T cell Ig and mucin domain-1 (Tim-1) with anti-Tim-1 overcomes transplantation tolerance resistance. PMID: 19528638

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.