Recombinant Mouse TIM 1 Protein
Beta LifeScience
SKU/CAT #: BLA-10126P
Recombinant Mouse TIM 1 Protein
Beta LifeScience
SKU/CAT #: BLA-10126P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q5QNS5 |
Synonym | CD365 HAVCR HAVCR 1 HAVcr-1 Havcr1 Hepatitis A virus cellular receptor 1 Kidney injury molecule 1 KIM 1 KIM-1 T cell immunoglobin domain and mucin domain protein 1 T cell immunoglobulin mucin family member 1 T cell immunoglobulin mucin receptor 1 T-cell immunoglobulin and mucin domain-containing protein 1 T-cell membrane protein 1 TIM TIM-1 TIM1 TIMD 1 TIMD-1 TIMD1 TIMD1_HUMAN |
Description | Recombinant Mouse TIM 1 Protein was expressed in Insect cells. It is a Protein fragment |
Source | Insect cells |
AA Sequence | YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHR VTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKV TFSLQVKPEIPTRPPTRPTTTRPTATGRPTTISTRSTHVPTSIRVSTSTP PTSTHTWTHKPEPTTFCPHETTAEVTGIPSHTPTDWNGTVTSSGDTWSNH TEAIPPGKPQKNPTKGHHHHHH |
Molecular Weight | 24 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, TIM family |
Database References | |
Tissue Specificity | Expressed by stimulated T-cells. Expressed during primary antigen stimulation. |
Gene Functions References
- findings show that TIM1 is not required for hepatitis A virus (HAV) replication and pathogenesis in permissive strains of mice, although it may facilitate early stages of infection by binding phosphatidylserine on the quasi-enveloped HAV surface PMID: 28874468
- findings provide evidence for the role of Tim-1 in the induction of a cytokine storm phenomenon and the pathogenesis of Ebola virus disease PMID: 28951472
- Cisplatin enhances kidney injury molecule-1 (Kim-1) gene expression in kidney S3 cells. PMID: 27591740
- By preventing ERK1/2 phosphorylation following renal injury, STAT3 phosphorylation is decreased, leading to less phosphorylated STAT3 within the nucleus, and subsequently less KIM-1 mRNA increases post injury PMID: 29074644
- Study used a previously described highly mobile membrane mimetic membrane in combination with a conventional lipid bilayer model to generate a membrane-bound configuration of Tim1 in silico, identified two possible states for a membrane-bound form of Tim1. PMID: 28978444
- Our data reveal a previously unknown role for Galpha12 in regulating efferocytosis and that renal tubular epithelial cells require KIM-1 to mediate this process. PMID: 26697979
- Urinary L-FABP, NGAL, Kim-1 and albumin levels increased during the acute phase of kidney injury and were significantly correlated with the degree of tubulointerstitial fibrosis during the chronic phase. These markers could detect higher risk of progression to CKD. PMID: 27028054
- Blockade of Tim-1 changes Th1/Th2 balance and reduces circulating regulatory T cells to enhance atherosclerosis in LDL receptor knockout mice. PMID: 26821944
- Our results suggest that KIM-1 is an endogenous protective mechanism against renal ischemia-reperfusion injury PMID: 25759266
- data suggest that TIM-1 signaling plays a direct role in Breg maintenance and induction both under physiological conditions (in response to ACs) and in response to therapy through TIM-1 ligation PMID: 25645598
- Deletion of the mucin domain impaired KIM-1-mediated phagocytic function, resulting in increased proinflammatory cytokine production, decreased antiinflammatory growth factor secretion by proximal epithelial cells, and an increase in tissue macrophages. PMID: 25751064
- Tim-1 is critical for maintaining self-tolerance by regulating IL-10 production in Bregs PMID: 25582854
- blood biomarker that specifically reflects acute and chronic kidney injury PMID: 24904085
- Tim-1 expression was lower in a herpes simplex virus-induced Behcet's disease (BD) mouse model compared to that in asymptomatic BD normal (BDN) mice. PMID: 24453431
- Tim-1-Fc protects cardiac grafts from chronic rejection by suppressing CD4 Th17 development and functionality. PMID: 24551271
- KIM-1 shedding is accelerated by worsening renal cellular injury, and excess soluble KIM-1 competitively inhibits efferocytosis. PMID: 24829508
- Endogenous Tim-1 promotes severe systemic autoimmunity and renal disease MRL-Fas(lpr) mice. PMID: 24623145
- a major P-selectin ligand with a role in T cell trafficking during inflammatory responses and the induction of autoimmune disease PMID: 24703780
- Sustained KIM-1 expression promotes kidney fibrosis and provides a link between acute and recurrent injury with progressive chronic kidney disease. PMID: 23979159
- We defined a novel pathway in which TIM-1, a receptor for phosphatidylserine expressed by apoptotic cells, drives the development of asthma by sensing and responding to injured and apoptotic airway epithelial cells. PMID: 23672783
- TIM-1 expressing CD4 T cells are required in the mechanism of innate immune-mediated hepatic IRI in OLTs PMID: 23137033
- Tim-1 plays a critical role in maintaining suppressive regulatory B-cell function, while it's mucin domain plays an unexpected role in regulating Breg function and maintaining self-tolerance. PMID: 22773818
- Endogenous Tim-1 promotes Th1 and Th17 nephritogenic immune responses and its neutralization reduces renal injury while limiting inflammation in cell-mediated glomerulonephritis. PMID: 22205357
- Tim-1 functions in pathways that suppress recruitment of inflammatory cells into the airways and the generation or activity of CD4+ T cells. PMID: 22144095
- Tim-1 expression declined in Helicobacter pylori infection. PMID: 21923683
- Data show that in vivo in mice, TIM-1 is predominantly expressed on B rather than T cells, and is an inclusive marker for IL-10+ Bregs that can be induced by TIM-1 ligation. PMID: 21821911
- Tim1 and Tim3 are not essential for the induction of the type-2 response in lung allergy. PMID: 21470319
- mAb stimulation on dendritic cells regulates the balance between effector and regulatory T cells and induces Experimental autoimmune encephalitis PMID: 21469101
- The TIM-1:TIM-4 pathway enhances injury after renal ischemia-reperfusion injury and may be a therapeutic target. PMID: 21355054
- These results suggest that TIM-1 signaling in B cells augments antibody production by enhancing B cell proliferation and differentiation. PMID: 21303660
- results suggest that TIM-1 serves as a pattern recognition receptor on NKT cells that senses PtdSer on apoptotic cells as a damage-associated molecular pattern PMID: 20889552
- Tim-1 is induced on germinal centre B cells through BCR signaling. PMID: 20518819
- TIM1 is an endogenous ligand for LMIR5. PMID: 20566714
- Late upregulation of KIM-1 and NGAL could be a useful marker for sustained renal injury after acute kidney injury. PMID: 20181666
- TIM1 costimulation on hepatic natural killer T cells enhances cellular production of interleukin (IL)-4 while inhibiting the production of interferon (IFN)-gamma. PMID: 20220086
- TIM-1 regulates not only T for the role of cell activation but may also affect macrophage function in the local inflammation response. PMID: 20091883
- protective effects of hepatitis A virus on atopic disease depends on a common TIM-1 allele PMID: 14534576
- TIM-1 is a molecule that costimulates T cell activation PMID: 15793575
- TIM-1-TIM-4 interaction is involved in regulating T cell proliferation PMID: 15793576
- TIM-1 is expressed on CD4+ T cells of the lung-draining lymph nodes after intranasal immunization and plays a role in T cell activation and differentiation. PMID: 16284246
- These results explain the divergent immune functions described for the murine receptors and the role of TIM-1 as a cell adhesion receptor in renal regeneration and cancer. PMID: 17363299
- The Ig domains of murine TIM1, 3 and 4 display calcium-dependent binding to carbohydrate ligands expressed by murine splenocytes and non-murine cell lines. Both homo- and heterotypic interactions were observed for binding between the TIM proteins. PMID: 17513880
- Tim-1 regulates T cell responses and can alter T cell function depending on the affinity/avidity with which it is engaged. PMID: 17606630
- In vivo abrogation of TIM-4 or its cognate ligand TIM-1 by using a polyclonal antibody remarkably dampened Th2 differentiation and intestinal allergy. TIM-4 as a novel molecule critically required for the development of intestinal allergy. PMID: 17915221
- Ligation of Tim-1 in vitro effectively deprogrammed Tregs and thus produced Tregs unable to control T cell responses. PMID: 18079964
- TIM-4 and TIM-1 are immunologically restricted members of the group of receptors whose recognition of PS is critical for the efficient clearance of apoptotic cells and prevention of autoimmunity. PMID: 18082433
- These studies define previously unknown functions of TIM-1 in regulating alloimmune responses in vivo . PMID: 18172549
- These results demonstrate that TIM-1 is significantly increased in pulmonary tissues and PBMCs in asthmatic mice after ovalbumin challenge, and that the production of TIM-1 as well as GATA-3 is upregulated in the spleen of asthmatic mice. PMID: 18234236
- Ligation of Tim-1 in the presence of mature dendritic cells triggers polyclonal T cell activation. PMID: 19155484
- Results demonstrate that targeting T cell Ig and mucin domain-1 (Tim-1) with anti-Tim-1 overcomes transplantation tolerance resistance. PMID: 19528638