Recombinant Mouse Thrombopoietin Protein

Beta LifeScience SKU/CAT #: BLA-10116P

Recombinant Mouse Thrombopoietin Protein

Beta LifeScience SKU/CAT #: BLA-10116P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession P40226
Synonym C mpl ligand C-mpl ligand Megakaryocyte colony stimulating factor Megakaryocyte colony-stimulating factor Megakaryocyte growth and development factor Megakaryocyte stimulating factor MGC163194 MGDF MKCSF ML MPL ligand MPLLG Myeloproliferative leukemia virus oncogene ligand Prepro thrombopoietin THCYT1 THPO Thrombopoietin Thrombopoietin nirs variant 1 TPO TPO_HUMAN
Description Recombinant Mouse Thrombopoietin Protein was expressed in Insect cells. It is a Full length protein
Source Insect cells
AA Sequence SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGE WKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLL LGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTL CVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSR LQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLE ASDISPGAFNKGSLAFNLQGGLPPSPSLAPDGHTPFPPSPALPTTHGSPP QLHPLFPDPSTTMPNSTAPHPVTMYPHPRNLSQET
Molecular Weight 66 kDa
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity ED50 < 5 ng/ml as determined in a cell proliferation assay using Human TF-1 erythroleukemia cells.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C.

Target Details

Target Function Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Subcellular Location Secreted.
Protein Families EPO/TPO family
Database References
Tissue Specificity Found mainly in the liver, kidney and skeletal muscle.

Gene Functions References

  1. Increased TPO expression in HSCs following IL-11 exposure could be mimicked or blocked by inhibiting or overexpressing miR-204-5p, respectively... IL-11 promoted Hematopoietic stem cell engraftment in a mouse model of aplastic anemia an effect that was attenuated in cells overexpressing miR-204-5p. PMID: 29217821
  2. this study assessed the physiological source of thrombopoietin, a key cytokine required for maintaining hematopoietic stem cell . PMID: 29622652
  3. TPO and its receptor Mpl are dispensable for platelet survival in adult mice PMID: 27344013
  4. Furthermore, although the contribution of the TPO treated graft to long-term hematological engraftment was reduced, the TPO treated and untreated grafts both contributed significantly to long-term chimerism in vivo. PMID: 25137252
  5. TPO treatment also promoted the peripheral induction of Foxp3(+) Tregs in conjunction with elevated circulating TGF-beta levels. PMID: 25212676
  6. novel findings about aspects of TPO action on stem cells PMID: 25564715
  7. Mpl expression, but not Tpo, is fundamental in the development of JAK2V617F(+) myeloproliferative neoplasms PMID: 25339357
  8. Thrombopoietin/MPL signaling confers growth and survival capacity to CD41-positive cells in a mouse model of Evi1 leukemia. PMID: 25298035
  9. Megakaryocytes regulate cell cycle quiescence of hematopoietic stem cell through the production of thrombopoietin. PMID: 25451253
  10. IEX-1 has a role in activation of Erk and NF-kB pathways, which affects thrombopoietin-promoted NHEJ DNA repair in hematopoietic stem cells PMID: 24184684
  11. Findings establish that Clock regulates Thpo and Mpl expression in vivo, and demonstrate an important link between the body's circadian timing mechanisms and megakaryopoiesis. PMID: 22284746
  12. Signal transduction pathway of ERK1/2 participates in the activation of thrombopoietin in inflammatory injury of BV2 cells. PMID: 21507308
  13. The implication of Tpo as a mediator of neuronal damage in experimental pneumococcal meningitis is reported. PMID: 21149592
  14. Administration of recombinant human IL11 after supralethal radiation exposure promotes survival in mice: interactive effect with thrombopoietin PMID: 12005542
  15. glycan domain of thrombopoietin acts in trans to enhance secretion of the hormone and other cytokines PMID: 12101178
  16. Thrombopoietin expands hematopoietic stem cells after transplantation PMID: 12163458
  17. p38 mitogen-activated protein kinase (MAPK) was responsible for the TPO-induced Hoxb4 elevation PMID: 12855555
  18. Mpl stimulation by TPO results in the activation of Lyn kinase, which appears to limit the proliferative response through a signaling cascade that regulates MAPK activity PMID: 14726379
  19. Thrombopoietin induces HOXA9 nuclear transport in immature hematopoietic cells PMID: 15254242
  20. mpl-tpo signaling pathways are negatively modulated by lnk PMID: 15337790
  21. is strongly proapoptotic in the brain, causing death of newly generated neurons through the Ras-extracellular signal-regulated kinase 1/2 pathway PMID: 15642952
  22. TPO(high) and GATA-1(low) alterations are linked in an upstream-downstream relationship along a pathobiologic pathway leading to development of myelofibrosis PMID: 15665119
  23. Development of myelofibrosis and osteosclerosis depends on local TPO levels in Bone marrow cells. PMID: 15927672
  24. Thrombopoietin synthesis is induced by IL-6 in the liver during acute inflammation. PMID: 16022585
  25. results suggest that a balance in positive and negative signals downstream from the TPO signal plays a role in the regulation of the probability of self-renewal in HSCs PMID: 17284614
  26. thrombopoietin has a role in mast cell differentiation [review] PMID: 17468237
  27. Chronic TPO overexpression induces mesangioproliferative glomerulopathy. PMID: 17546634
  28. roles for FAK in megakaryocyte growth and platelet function, setting the stage for manipulation of this component of the Tpo signaling apparatus for therapeutic benefit. PMID: 17925492
  29. Transcriptional regulation of bone marrow thrombopoietin by platelet proteins.( PMID: 18410987
  30. TPO induces HIF-1alpha expression in a manner very similar to that of hypoxia. PMID: 18473128
  31. thrombopoietin potentiates vasculogenesis by enhancing motility and enlivenment of transplanted endothelial progenitor cells via activation of Akt/mTOR/p70S6kinase signaling pathway PMID: 18773906
  32. TPO downmodulates c-Myb expression through induction of miR-150. PMID: 18814950

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Other Recombinant Proteins
Greater than 90% as determined by SDS-PAGE.
Recombinant Juniperus Ashei Pectate Lyase 1
  • Molecule: Pectate Lyase 1;
  • Species: Juniperus ashei ;
  • Expression system: Yeast;
  • Tag: Tag-Free;
  • Sequence: Full Length Protein;
CAT#: BLC-02231P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Acyl-Coa-Binding Protein (ACB1) Protein (His)
  • Molecule: ACB1;
  • Species: Yeast;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-08185P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC 50 of human PEX19 is 22.96-33.00 μg/ml.
Recombinant Human Atp-Binding Cassette Sub-Family D Member 1 (ABCD1) Protein (His), Active
  • Molecule: ABCD1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-05645P

Online Inquiry
Greater than 85% as determined by SDS-PAGE.
Recombinant Acinetobacter Baumannii Efflux Pump Membrane Transporter (HMPREF0010_00594) Protein (His)
  • Molecule: HMPREF0010_00594;
  • Species: Acinetobacter baumannii ;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-00395P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Ctenocephalides Felis Salivary Antigen 1 Protein (His-SUMO)
  • Molecule: Salivary Antigen 1;
  • Species: Ctenocephalides felis ;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-08547P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC 50 of human BZM2 is 45.42-72.22 μg/ml.
Recombinant Human Metalloendopeptidase Oma1, Mitochondrial (OMA1) Protein (His-SUMO), Active
  • Molecule: OMA1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-05648P

Online Inquiry
Recently viewed