Recombinant Mouse Tenascin Protein

Beta LifeScience SKU/CAT #: BLA-10115P
Recombinant Mouse Tenascin Protein

Recombinant Mouse Tenascin Protein

Beta LifeScience SKU/CAT #: BLA-10115P
Catalog No.: BLA-10115P

Product Overview

Host Species Mouse
Accession Q80YX1
Synonym Cytotactin Glioma associated extracellular matrix antigen GMEM GP 150 225 Hexabrachion HXB JI Myotendinous antigen Neuronectin Tenascin C TenascinC TN TN C TNC
Description Recombinant Mouse Tenascin Protein was expressed in Mammalian. It is a Protein fragment
Source Mammalian
AA Sequence GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWI VFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRV DLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFST YDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKG HEYSIQFAEMKLRPSN
Molecular Weight 241 kDa
Purity >90% by SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed