Recombinant Mouse Telomerase reverse transcriptase Protein (Tagged)

Name: Recombinant Mouse Telomerase reverse transcriptase Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10111P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	O70372
Synonym	CMM9 DKCA2 DKCB4 EST2 HEST2 htert hTRT PFBMFT1 TCS1 Telomerase associated protein 2 Telomerase catalytic subunit Telomerase reverse transcriptase Telomerase-associated protein 2 Telomere Reverse Transcriptase TERT TERT_HUMAN TP2 TRT
Description	Recombinant Mouse Telomerase reverse transcriptase Protein (Tagged) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	EVRHHQDTWLAMPICRLRFIPKPNGLRPIVNMSYSMGTRALGRRKQAQHF TQRLKTLFSMLNYERTKHPHLMGSSVLGMNDIYRTWRAFVLRVRALDQTP RMYFVKADVTGAYDAIPQGKLVEVVANMIRHSESTYCIRQYAVVRRDSQG QVHKSFRRQVTTLSDLQPYMGQFLKHLQDSDASALRNSVVIEQSISMNES SSSLFDFFLHFLRHSVVKIGDRCYTQCQGIPQGSSLSTLLCSLCFGDMEN KLFAEVQRDGLLLRFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQ KTVVNFPVEPGTLGGAAPYQLPAHCLFPWCGLLL
Molecular Weight	54 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regulated by a number of factors including telomerase complex-associated proteins, chaperones and polypeptide modifiers. Modulates Wnt signaling. Plays important roles in aging and antiapoptosis.
Subcellular Location	Nucleus, nucleolus. Nucleus, nucleoplasm. Nucleus. Chromosome, telomere. Cytoplasm. Nucleus, PML body.
Protein Families	Reverse transcriptase family, Telomerase subfamily
Database References	KEGG: mmu:21752 STRING: 10090.ENSMUSP00000022104 UniGene: Mm.10109
Tissue Specificity	High activity in intestine, liver and testis, moderate in lung, very low in muscle, heart and brain.

Gene Functions References

Par-4 activation and binding to TERT are key steps required for inducing the apoptosis of islet beta cells under high-glucose/fatty acid conditions in type 2 diabetes. PMID: 30186877
Tert-deficient but not Terc-deficient mice develop hepatocyte injury and frank steatosis when challenged with liquid high-fat diet. PMID: 28741793
identification of a subset of hepatocytes that expresses high levels of telomerase and show that this hepatocyte subset repopulates the liver during homeostasis and injury PMID: 29618815
These preclinical data in mouse models and human cells provide a strong rationale for the development of pharmacological approaches to target BMI1-mediated mitochondrial regulation and protection from DNA damage to sustain the regenerative potential of the skeletal muscle in conditions of chronic muscle wasting. PMID: 28757168
Reactivation of Tert in the hippocampus was sufficient to normalize the depressive but not the aggressive behaviors of Tert(-/-) mice. Conversely, re-expression of Tert in the medial prefrontal cortex (mPFC) reversed the aggressive but not the depressive behavior of Tert(-/-) mice. PMID: 27300262
Nrf2-driven TERT regulates pentose phosphate pathway in glioblastoma. PMID: 27148686
TERT has a role in neointima formation through epigenetic regulation of proliferative E2F1 target gene expression in smooth muscle cells. PMID: 27932351
these findings support a model in which gain of TERT function modulates mTORC1 activity and induces autophagy. PMID: 27545609
Regarding extratelomeric activities, our results showed a decrease of 64, 38 and 25% in the transcription of c-Myc, Cyc-D1 and TERT, respectively (p<0.05) after AZT treatment. Furthermore, we found an effect on cell migration, reaching an inhibition of 48% (p<0.05) and a significant passage-dependent increase on cell doubling time during treatment PMID: 27633795
Results suggest that in mature Purkinje neurons, TERT is present both in the nucleus and in mitochondria, where it may participate in adaptive responses of the neurons to excitotoxic and radiation stress PMID: 26374457
Wnt10a/beta-catenin signaling pathway is able to exacerbate keloid cell proliferation and inhibit the apoptosis of keloid cells through its interaction with TERT. PMID: 27771714
This study reports the characterisation of two novel mouse TERT splice variants, Ins-i1[1-102] (Insi1 for short) and Del-e12[1-40] (Dele12 for short) that have not been previously described. Insi1 represents an in-frame insertion of nucleotides 1-102 from intron 1, encoding a 34 amino acid insertion at amino acid 73. PMID: 26787169
TERT may promote gastric cancer metastasis through the TERT-miR-29a-ITGB1 regulatory pathway. PMID: 26903137
TERT switches macrophages towards M1 phenotype by regulating NF-kappaB signaling, but has limited effect on M2 macrophages polarization in vitro. PMID: 26725521
The results suggest that the mouse endometrial epithelium and vasculature are foci of stem/progenitor activity expressing mTert. PMID: 26740067
miR-195 overexpressed in old mesenchymal stem cells (OMSCs) induces stem cell senescence deteriorating their regenerative ability by directly deactivating telomerase reverse transcriptase (Tert), and abrogation of miR-195 can reverse stem cell aging. PMID: 26390028
These findings indicate that telomerase gene therapy represents a novel therapeutic strategy to treat aplastic anemia provoked or associated with short telomeres. PMID: 26903545
findings identified a key role for TERT in fibroblast proliferation and survival essential for pulmonary fibrosis PMID: 26555817
miR-512-5p suppresses tumor growth by targeting TERT in telomerase positive head and neck squamous cell carcinoma in vitro and in vivo. PMID: 26258591
Telomerase deficiency triggers alveolar stem cell replicative senescence-associated low-grade inflammation. PMID: 26518879
high telomerase expression is a fundamental characteristic of germline stem cells. PMID: 26584619
data suggest that S1P binding to hTERT allosterically mimicks phosphorylation, promoting telomerase stability and hence telomere maintenance, cell proliferation, and tumor growth. PMID: 26082434
Telomerase may direct Pol I transcription in oncogenic and regenerative hyperproliferation. PMID: 25118183
Tert expression confers cardioprotection in the adult mouse heart after acute myocardial infarction. PMID: 25519492
TERT is a regulator of MYC stability in cancer. Reactivation of TERT, a direct transcriptional MYC target in tumors, provides a feed-forward mechanism to potentiate MYC-dependent oncogenesis. PMID: 25893605
Pharmacologically relevant doses of atorvastatin resulted in a 6-fold increase of telomerase activity in mouse PBMCs and CD4 T cells. Transgenic GFP-mTert reporter mice had 30% to 15% less telomerase-positive lymphocytes during the first 5 months of age. PMID: 25127175
Studies indicate that reverse transcriptase (RT) enzyme highly expressed in mouse embryos and mouse and human cancer cells and repressed in somatic differentiated healthy cells. PMID: 25586649
The overexpression of Zfp637 markedly increases mTERT expression and telomerase activity, maintains telomere length, and inhibits H2O2 and D-galactose-induced senescence. PMID: 25032857
Telomerase exerts telomere-independent effects on pulmonary artery smooth muscle cell growth in pulmonary hypertension. PMID: 25550449
These findings establish a functional link between endoplasmic reticulum stress and telomerase. PMID: 24119029
TERT, combined with beta-catenin and BRG1, serves as a transcriptional complex, which binds the FAS ligand (FASL) promoter to upregulate FASL expression, leading to an elevated immunomodulatory function. PMID: 24401839
These data indicate that TERT plays an extratelomeric role in the reprogramming process, but its function is dispensable. PMID: 24733392
Once HIV production had reached a peak (7 dpi), the telomerase activity decreased, showing levels similar to those of noninfected cells PMID: 24254728
Overexpression of TERT in mesenchmal stem cells resulted in increased cell proliferation. PMID: 22884695
TERT expression was up-regulated by a histone deacetylase inhibitor, while the induction of TERT in lung fibroblasts was associated with the binding of acetylated histone H3K9 to the TERT promoter region. PMID: 23526226
calorie restriction attenuates telomere erosion associated to aging and that synergizes with TERT over-expression in increasing "health span" and extending mouse longevity PMID: 23349740
prepared two mutant forms of the PhSurv-PhTERT tandem with two or four Sp1 sites removed from the distal "long" PhSurv promoter PMID: 23056318
Study identified the cells responsible for cardiac telomerase activity, demonstrates a significant diminution with age. PMID: 22919071
mir498 has a role in 1,25-Dihydroxyvitamin D3 suppression of telomerase expression and cancer growth PMID: 23055531
Data show that AUF1 binds and strongly activates the transcription promoter for telomerase catalytic subunit Tert. PMID: 22633954
Essential role for telomerase in chronic myeloid leukemia induced by BCR-ABL in mice. PMID: 22408137
telomerase plays a role in the aging of nondividing cells PMID: 22533433
findings show beta-catenin regulates Tert expression through interaction with Klf4, a core component of the pluripotency transcriptional network; beta-Catenin binds to the Tert promoter in a mouse intestinal tumor model PMID: 22723415
Data provide evidence that telomere dysfunction plays a critical role in prostate cancer initiation and progression, permitting acquisition of and selection for cancer-relevant genomic events upon telomerase reactivation. PMID: 22341455
Silencing transgenic TERT expression or inhibiting Wnt signaling through systemic expression of the Wnt inhibitor Dkk1 in either TERT transgenic mice or in a mouse model of HIVAN results in marked normalization of podocytes PMID: 22138751
Selenium and benzene can upregulate the telomerase activity in mouse lymphocytes in vivo. PMID: 19080380
Hippocampal telomerase is involved in the modulation of depression-related behaviors, possibly by regulating adult neurogenesis. PMID: 21865469
Primitive hematopoietic Tert(-/-) cells lacking telomerase activity exhibit signs of enhanced DNA damage. PMID: 21730353
Results indicate that both telomerase reverse transcriptase and telomerase RNA are haploinsufficient and that their deficiency leads to telomere shortening, which limits tissue renewal. PMID: 21464209
The results of this study provide the first experimental evidence that telomere shortening, despite impairing adult neurogenesis and maintenance of post-mitotic neurons, can slow down the progression of amyloid plaque pathology in Alzheimer's disease. PMID: 21672962

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.