Recombinant Mouse SRPX2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10101P
Recombinant Mouse SRPX2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10101P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q8R054 |
Synonym | BPP CBPS PMGX RESDX SRPUL SRPX 2 SRPX2 SRPX2_HUMAN Sushi repeat containing protein SRPX2 Sushi repeat containing protein X linked 2 Sushi repeat protein Sushi repeat-containing protein SRPX2 |
Description | Recombinant Mouse SRPX2 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCY SPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRC HTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGG EPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVT LRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQH GYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPM KINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLD LRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLID KQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE |
Molecular Weight | 71 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations. |
Subcellular Location | Secreted. Cytoplasm. Cell surface. Cell junction, synapse. |
Database References | |
Tissue Specificity | Expressed in angiogenic endothelial cells (at protein level). |