Recombinant Mouse SPR Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10100P
Recombinant Mouse SPR Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10100P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | NP_035597 |
Synonym | OTTHUMP00000160199 SDR38C1 Sepiapterin reductase Sepiapterin reductase (7,8 dihydrobiopterin:NADP+ oxidoreductase) Short chain dehydrogenase/reductase family 38C, member 1 SPR SPRE_HUMAN |
Description | Recombinant Mouse SPR Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMEAGGLGCAVCVLTGASRGFGRALAPQ LARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGV QRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWAL NLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAA RDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLK SDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYDC |
Molecular Weight | 30 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |