Recombinant Mouse SOCS1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10094P
Recombinant Mouse SOCS1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10094P
Catalog No.: BLA-10094P
Product Overview
| Host Species | Mouse |
| Accession | O35716 |
| Synonym | CISH 1 CISH1 Cytokine inducible SH2 protein 1 JAB JAK binding protein JAK-binding protein Janus kinase binding protein SOCS 1 SOCS-1 Socs1 SOCS1_HUMAN SSI 1 SSI-1 SSI1 STAT induced STAT inhibitor 1 STAT-induced STAT inhibitor 1 Suppressor of cytokine signaling 1 Supressor of cytokine signalling 1 TEC interacting protein 3 Tec-interacting protein 3 TIP 3 TIP-3 TIP3 |
| Description | Recombinant Mouse SOCS1 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | MVARNQVAADNAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPA PGDTHFRTFRSHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVG TFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRETFDCLFE LLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVAAVGRENLARIPLNPV LRDYLSSFPFQI |
| Molecular Weight | 29 kDa including tags |
| Purity | >85% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
