Name: Recombinant Mouse SLC7A10 Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10092P
Availability: InStock

Catalog No.: BLA-10092P

Host Species	Mouse
Accession	P63115
Synonym	AAA1_HUMAN ASC-1 Asc-type amino acid transporter 1 D-serine transporter HASC 1 Slc7a10 solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10 Solute carrier family 7 member 10 solute carrier family 7, (cationic amino acid transporter, y+ system) member 10 solute carrier family 7, (neutral amino acid transporter, y+ system) member 10
Description	Recombinant Mouse SLC7A10 Protein (Tagged) was expressed in Yeast. It is a Protein fragment
Source	Yeast
AA Sequence	WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.