Recombinant Mouse SLC7A10 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10092P
Recombinant Mouse SLC7A10 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10092P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P63115 |
Synonym | AAA1_HUMAN ASC-1 Asc-type amino acid transporter 1 D-serine transporter HASC 1 Slc7a10 solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10 Solute carrier family 7 member 10 solute carrier family 7, (cationic amino acid transporter, y+ system) member 10 solute carrier family 7, (neutral amino acid transporter, y+ system) member 10 |
Description | Recombinant Mouse SLC7A10 Protein (Tagged) was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse. |
Subcellular Location | Membrane; Multi-pass membrane protein. |
Protein Families | Amino acid-polyamine-organocation (APC) superfamily |
Database References | |
Tissue Specificity | Highly expressed in brain and lung, and to a lesser extent in placenta and small intestine. |
Gene Functions References
- this study shows that the astrocytic transporter SLC7A10 mediates glycinergic inhibition of spinal cord motor neurons PMID: 27759100
- Asc-1 has a novel role in regulating NMDA receptor-dependent synaptic activity by mediating concurrent non-vesicular release of D-serine and glycine. PMID: 23426681
- The alanine-serine-cysteine-1 (Asc-1) transporter controls glycine levels in the brain and is required for glycinergic inhibitory transmission PMID: 25755256
- The amino acid transporter ASC-1 is a white adipocyte-specific cell surface protein. PMID: 25080478
- Lack of the alanine-serine-cysteine transporter 1 causes tremors, seizures, and early postnatal death in mice. PMID: 16026768
- The results presented reveal that Asc-1 is the only high affinity D-serine transporter in the mouse CNS and is the predominant mechanism for D-serine reuptake. PMID: 17432963