Recombinant Mouse SLC32A1/VGAT Protein
Beta LifeScience
SKU/CAT #: BLA-10091P
Recombinant Mouse SLC32A1/VGAT Protein
Beta LifeScience
SKU/CAT #: BLA-10091P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | O35633 |
Synonym | bA122O1.1 GABA and glycine transporter hVIAAT SLC32A 1 Slc32a1 solute carrier family 32 (GABA vesicular transporter) member 1 Solute carrier family 32 member 1 Vesicular GABA Amino Acid Transporter Vesicular GABA transporter Vesicular inhibitory amino acid transporter VGAT VIAAT VIAAT_HUMAN |
Description | Recombinant Mouse SLC32A1/VGAT Protein was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDL DFEHRQGLQMDILKSEGEPCGDEGAEAPVEGDIHYQRGGAPLPPSGSKDQ AVGAGGEFGGHDKPKITAWEAGWNVTNAIQGMF |
Molecular Weight | 14 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |