Recombinant Mouse SLC32A1/VGAT Protein

Beta LifeScience SKU/CAT #: BLA-10091P
Recombinant Mouse SLC32A1/VGAT Protein

Recombinant Mouse SLC32A1/VGAT Protein

Beta LifeScience SKU/CAT #: BLA-10091P
Catalog No.: BLA-10091P

Product Overview

Host Species Mouse
Accession O35633
Synonym bA122O1.1 GABA and glycine transporter hVIAAT SLC32A 1 Slc32a1 solute carrier family 32 (GABA vesicular transporter) member 1 Solute carrier family 32 member 1 Vesicular GABA Amino Acid Transporter Vesicular GABA transporter Vesicular inhibitory amino acid transporter VGAT VIAAT VIAAT_HUMAN
Description Recombinant Mouse SLC32A1/VGAT Protein was expressed in Yeast. It is a Protein fragment
Source Yeast
AA Sequence MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDL DFEHRQGLQMDILKSEGEPCGDEGAEAPVEGDIHYQRGGAPLPPSGSKDQ AVGAGGEFGGHDKPKITAWEAGWNVTNAIQGMF
Molecular Weight 14 kDa
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed