Recombinant Mouse SLC32A1/VGAT Protein
Beta LifeScience
SKU/CAT #: BLA-10091P

Recombinant Mouse SLC32A1/VGAT Protein
Beta LifeScience
SKU/CAT #: BLA-10091P
Catalog No.: BLA-10091P
Product Overview
Host Species | Mouse |
Accession | O35633 |
Synonym | bA122O1.1 GABA and glycine transporter hVIAAT SLC32A 1 Slc32a1 solute carrier family 32 (GABA vesicular transporter) member 1 Solute carrier family 32 member 1 Vesicular GABA Amino Acid Transporter Vesicular GABA transporter Vesicular inhibitory amino acid transporter VGAT VIAAT VIAAT_HUMAN |
Description | Recombinant Mouse SLC32A1/VGAT Protein was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDL DFEHRQGLQMDILKSEGEPCGDEGAEAPVEGDIHYQRGGAPLPPSGSKDQ AVGAGGEFGGHDKPKITAWEAGWNVTNAIQGMF |
Molecular Weight | 14 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |