Recombinant Mouse SI-CLP Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10089P
Recombinant Mouse SI-CLP Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10089P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q922Q9 |
Synonym | CHID1 CHID1_HUMAN Chitinase domain containing 1 Chitinase domain-containing protein 1 FLJ42707 GL008 MGC3234 PSEC0104 SB139 SI-CLP SICLP Stabilin 1 interacting chitinase like protein Stabilin-1-interacting chitinase-like protein |
Description | Recombinant Mouse SI-CLP Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCS SRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGRE MFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDE IEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQA RLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQP GPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGA RYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLEL ARELGVGVSIWELGQGLDYFYDLL |
Molecular Weight | 44 kDa |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro). |
Subcellular Location | Secreted. Lysosome. |
Protein Families | Glycosyl hydrolase 18 family |
Database References |