Name: Recombinant Mouse SHANK3 Protein
Brand: Beta LifeScience
SKU: BLA-10088P
Availability: InStock

Catalog No.: BLA-10088P

Host Species	Mouse
Accession	Q4ACU6
Synonym	AI841104 DEL22q13.3 KIAA1650 Proline rich synapse associated protein 2 Proline-rich synapse-associated protein 2 ProSAP2 PSAP2 SH3 and multiple ankyrin repeat domains 3 SH3 and multiple ankyrin repeat domains protein 3 SH3/ankyrin domain gene 3 SHAN3_HUMAN Shank postsynaptic density protein Shank3 Shank3b SPANK 2 SPANK2
Description	Recombinant Mouse SHANK3 Protein was expressed in Yeast. It is a Protein fragment
Source	Yeast
AA Sequence	DTRHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFG FVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEV NGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVTR
Molecular Weight	15 kDa
Purity	>85% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.