Recombinant Mouse SERPINE2/PN-1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10085P
Recombinant Mouse SERPINE2/PN-1 Protein (His tag)

Recombinant Mouse SERPINE2/PN-1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10085P
Catalog No.: BLA-10085P

Product Overview

Host Species Mouse
Accession Q07235
Synonym GDN GDN_HUMAN GDNPF Glia derived nexin Glia-derived nexin Glial derived neurite promoting factor P17 Peptidase inhibitor 7 Pi-7 Plasminogen activator inhibitor type 1, member 2 PN-1 PN1 PNI Protease inhibitor 7 Protease nexin 1 Protease nexin I Serpin E2 Serpin family E member 2 Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 SERPINE 2 Serpine2
Description Recombinant Mouse SERPINE2/PN-1 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein
Source Baculovirus infected insect cells
AA Sequence SQFNSLSLEELGSNTGIQVFNQIIKSRPHENVVVSPHGIASILGMLQLGA DGKTKKQLSTVMRYNVNGVGKVLKKINKAIVSKKNKDIVTVANAVFLRNG FKMEVPFAVRNKDVFQCEVQNVNFQDPASASESINFWVKNETRGMIDNLL SPNLIDGALTRLVLVNAVYFKGLWKSRFQPESTKKRTFVAGDGKSYQVPM LAQLSVFRSGSTRTPNGLWYNFIELPYHGESISMLIALPTESSTPLSAII PHITTKTIDSWMNTMVPKRMQLVLPKFTAVAQTDLKEPLKALGITEMFEP SKANFTKITRSESLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPW FIVDRPFLFSIRHNPTGAILFLGQVNKPLEHHHHHH
Molecular Weight 43 kDa including tags
Purity >95% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed