Name: Recombinant Mouse SCGB3A2 Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10082P
Availability: InStock

Catalog No.: BLA-10082P

Host Species	Mouse
Accession	Q920H1
Synonym	LU103 Pneumo secretory protein 1 PnSP-1 PNSP1 SCGB3A2 Secretoglobin family 3A member 2 SG3A2_HUMAN UGRP1 Uteroglobin-related protein 1
Description	Recombinant Mouse SCGB3A2 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDE LGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRD SKKQTFAFIERVFEQSKL
Molecular Weight	43 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.