Name: Recombinant Mouse SAA1 Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10080P
Availability: InStock

Catalog No.: BLA-10080P

Host Species	Mouse
Accession	P05366
Synonym	amyloid A, serum Amyloid fibril protein AA Amyloid protein A MGC111216 PIG4 SAA SAA2 Serum amyloid A protein serum amyloid A-1 protein serum amyloid A1 TP53I4 Tumor protein p53 inducible protein 4
Description	Recombinant Mouse SAA1 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGG VWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLP DKY
Molecular Weight	28 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.