Recombinant Mouse S100A4 Protein
Beta LifeScience
SKU/CAT #: BLA-8841P
Recombinant Mouse S100A4 Protein
Beta LifeScience
SKU/CAT #: BLA-8841P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P07091 |
Synonym | 18A2 42A calcium Placental protein Calvasculin CAPL Fibroblast specific protein Fibroblast specific protein 1 Fibroblast specific protein 1 (FSP1) FSP1 Leukemia multidrug resistance associated protein Malignant transformation suppression 1 Malignant transformation suppression 1 (MTS1) Metastasin MTS1 OTTHUMP00000015467 OTTHUMP00000015468 P9KA PEL98 Placental calcium-binding protein Protein Mts1 Protein S100 A4 Protein S100-A4 S100 calcium binding protein A4 S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) S100 calcium-binding protein A4 S100a4 S10A4_HUMAN |
Description | Recombinant Mouse S100A4 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLN KTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLS CIAMMCNEFFEGCPDKEPRKK |
Molecular Weight | 14 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |