Recombinant Mouse S100A4 Protein

Beta LifeScience SKU/CAT #: BLA-8841P
Recombinant Mouse S100A4 Protein

Recombinant Mouse S100A4 Protein

Beta LifeScience SKU/CAT #: BLA-8841P
Catalog No.: BLA-8841P

Product Overview

Host Species Mouse
Accession P07091
Synonym 18A2 42A calcium Placental protein Calvasculin CAPL Fibroblast specific protein Fibroblast specific protein 1 Fibroblast specific protein 1 (FSP1) FSP1 Leukemia multidrug resistance associated protein Malignant transformation suppression 1 Malignant transformation suppression 1 (MTS1) Metastasin MTS1 OTTHUMP00000015467 OTTHUMP00000015468 P9KA PEL98 Placental calcium-binding protein Protein Mts1 Protein S100 A4 Protein S100-A4 S100 calcium binding protein A4 S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) S100 calcium-binding protein A4 S100a4 S10A4_HUMAN
Description Recombinant Mouse S100A4 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLN KTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLS CIAMMCNEFFEGCPDKEPRKK
Molecular Weight 14 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed