Recombinant Mouse RSPO1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10079P
Recombinant Mouse RSPO1 Protein (His tag)

Recombinant Mouse RSPO1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10079P
Catalog No.: BLA-10079P

Product Overview

Host Species Mouse
Accession Q9Z132
Synonym CRISTIN3 FLJ40906 hRspo1 R spondin homolog R spondin homolog (Xenopus laevis) R spondin1 R-spondin-1 Roof plate specific spondin Roof plate-specific spondin-1 RP11-566C13.1 RSPO Rspo1 RSPO1_HUMAN
Description Recombinant Mouse RSPO1 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein
Source Baculovirus infected insect cells
AA Sequence ADPSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERN DIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEG LYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCG FRKGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQ GRRENANRHPARKNSKEPGSNSRRHKGQQQPQPGTTGPLTSVGPTWAQHH HHHH
Molecular Weight 28 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed