Recombinant Mouse Robo1 Protein (His tag)

Name: Recombinant Mouse Robo1 Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-10074P
Availability: InStock

Collections: Car-nk targets proteins, Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	O89026
Synonym	Deleted in U twenty twenty DUTT 1 DUTT1 FLJ21882 H Robo 1 H-Robo-1 hRobo 1 Robo 1 Robo1 ROBO1_HUMAN Roundabout 1 Roundabout axon guidance receptor homolog 1 Roundabout homolog 1 Roundabout homolog1 precurser Roundabout1 SAX 3 SAX3
Description	Recombinant Mouse Robo1 Protein (His tag) was expressed in Mammalian. It is a Protein fragment
Source	Mammalian
AA Sequence	YRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNIS EPATQPWLADTWPNTGNNHNDCSINCCTAGNGNSDSNLTTYSRPADCIAN YNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSG QPTPYATTQLIQANLSNNMNNGAGDSSEKHWKPPGQQKPEVAPIQYNIME QNKLNKDYRANDTIPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKG ARTPKAPKQGGMNWADLLPPPPAHPPPHSNSEEYNMSVDESYDQEMPCPV PPAPMYLQQDELQEEEDERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQ EELQPMLQDCPEDLGHMPHPPDRRRQPVSPPPPPRPISPPHTYGYISGPL VSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTG SMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKV ARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAVVIQKARPAKKQKHQP GHLRREAYADDLPPPPVPPPAIKSPTVQSKAQLEVRPVMVPKLASIEART DRSSDRKGGSYKGREALDGRQVTDLRTNPSDPREAQEQPNDGKGRGTRQP KRDLPPAKTHLGQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQRE QANVGRRNMAEMQVLGGFERGDENNEELEETES
Molecular Weight	181 kDa
Purity	>90% by SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Receptor for SLIT1 and SLIT2 that mediates cellular responses to molecular guidance cues in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. Interaction with the intracellular domain of FLRT3 mediates axon attraction towards cells expressing NTN1. In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex. Plays a role in the regulation of cell migration via its interaction with MYO9B; inhibits MYO9B-mediated stimulation of RHOA GTPase activity, and thereby leads to increased levels of active, GTP-bound RHOA. May be required for lung development.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass membrane protein.
Protein Families	Immunoglobulin superfamily, ROBO family
Database References	KEGG: mmu:19876 STRING: 10090.ENSMUSP00000023600 UniGene: Mm.310772
Tissue Specificity	Detected in embryonic thalamus neurons (at protein level). Expressed in embryonal spinal chord. Expressed in embryonal lung, and in adult lung bronchial epithelial cells of large proximal airways.

Gene Functions References

Low Robo1 expression is associated with developmental defects of cranial frontal and parietal bones. PMID: 28987541
Contralateral migration of oculomotor neurons is regulated by Slit/Robo signaling. Results demonstrate that a migratory subset of motor neurons respond to floor plate-derived Slit repulsion to properly control the timing of contralateral migration. PMID: 27770832
While Slit1 and Robo2 are only expressed in peripheral axons and their cell bodies, Slit2, Slit3 and Robo1 are also expressed in satellite cells of the dorsal root ganglion, Schwann cells and fibroblasts of peripheral nerves. PMID: 28234971
restoration of miR-218 inhibited retinal angiogenesis via targeting Robo1. MiR-218 contributed to the inhibition of retinal angiogenesis and miR-218 might be a new therapeutic target for preventing retinal neovascularization.. PMID: 26960375
Robo1-Slit2 interaction required for pathfinding mechanism essential to establish the functionally important habenulo-interpeduncular connection. PMID: 25366972
FLRT3 is a Robo1 coreceptor in developing axons. PMID: 24560577
Slit2/Robo1 signaling promotes intestinal tumorigenesis through Src-mediated activation of the Wnt/beta-catenin pathway. PMID: 25605242
Robo1/2 regulate follicle atresia through manipulating granulosa cell apoptosis in mice PMID: 25988316
Roundabout receptor (Robo) genes are expressed in pulmonary neuroendocrine cells (PNECs), a rare, innervated epithelial population. Robo inactivation in mouse lung results in an inability of PNECs to cluster into sensory organoids and triggers increased neuropeptide production upon exposure to air. PMID: 26743624
Cardiac defects in mutants for Robo or Slit range from membranous ventricular septum defects to bicuspid aortic valves. PMID: 25691540
Slit2 signaling through Robo1 and Robo2 has a role in retinal neovascularization PMID: 25894826
This study demonistrated that significant increase of interneurons in the cortices of Robo1-/- mice, implicate Robo1 in the regulation of progenitor cell dynamics in the developing forebrain. PMID: 24741061
we report that Robo1 plays an important role in guiding olfactory sensory neurons in the mouse olfactory system during development. PMID: 23821580
SDF-1-CXCR4 differentially regulates autoimmune diabetogenic T cell adhesion through ROBO1-SLIT2 interactions in mice. PMID: 23811810
These results demonstrate that Robo receptors play a crucial role in neocortical lamination and particularly in the positioning of layers II/III pyramidal neurons. PMID: 22661412
During stroke recovery, a transient reduction in Robo1 expression on the cerebral endothelial cells allowed the uncontrolled infiltration of polymorphonuclear neutrophils into the brain causing inflammatory reactions PMID: 23473743
Prostaglandin F2alpha upregulates Slit2 and Robo1 expression in mouse corpus luteum during luteolysis. PMID: 23814012
Slit/Robo signaling imposes a restriction force on spiral ganglia neurons to ensure their precise positioning for correct spiral ganglia-cochlear hair cells innervations. PMID: 23884932
Slit/Robo1 signaling is involved in regulating neural tube development by tightly coordinating cell proliferation and differentiation during neurulation. PMID: 23438940
Report role of Robo1 in development of the caval veins and pericardium. PMID: 23255421
Inactivation of Robo 1 leads to mispositioning of the stomach in the thoracic instead of the abdominal cavity, which likely contributes to poor lung inflation and lethality at birth, reminiscent of congenital diaphragmatic hernia. PMID: 23328398
This study report that central nervous system progenitors express Robo1 and Robo2, receptors for Slit proteins that regulate axon guidance, and that absence of these receptors or their ligands leads to loss of ventricular mitoses. PMID: 23083737
Modifications to spontaneous calcium activity encode a switch in the axon outgrowth program that allows establishment of specific neuronal connections through the transcriptional regulation of Slit1 and Robo1 signaling. PMID: 22772332
Robo1 and Robo2 are expressed in the nucleus origin of the tract of the postoptic commissure TPOC (nTPOC), while Slit expression domains flank the TPOC trajectory. PMID: 21688288
Robo1 is the predominant receptor for guiding axons in ventral tracts and prevents midline crossing. PMID: 21820427
Axons in the enlarged ventral funiculus of the srGAP3 KO are Robo1 positive but do not express Robo2, indicating that the thickening of the ventral funiculus in the srGAP3 KO is not a Robo2 mediated effect. PMID: 21655271
These results indicate that Slit1/2 - Robo1/2 signaling is critical during the initial establishment of dopaminergic pathways, with roles in the dorsoventral positioning and precise pathfinding of these ascending longitudinal axons. PMID: 21118670
During blood vessel formation microRNA-218 inhibits the expression of Robo1 (and that of Robo2) and thus the heparan sulfate biosynthetic pathway. PMID: 20947829
Robo1 prevents axonal stalling after crossing the floor plate at the spinal cord ventral midline PMID: 20631173
Robo1 inhibits choroidal and retinal angiogenesis in vitro. Robo1 is a potential target for the treatment of choroidal or retinal angiogenesis. PMID: 19958120
Dutt1/Robo1 expression was widespread and diffuse in the lung at embryonic day 17.5 but became increasingly localised to the bronchial epithelium in newborn and adult mice. PMID: 12123796
activation of the transmembrane receptor Activation of Roundabout (Robo) by its ligand, the secreted repulsive guidance cue Slit, inactivates N-cadherin-mediated cell adhesion in CNS growth cones. PMID: 12360290
Data suggest that the Slit family of axon guidance molecules (Slit 1-3) and their Robo 1 and 2 receptors contribute to the topographic targeting of basal vomeronasal axons. PMID: 12954717
In the spinal cord, midline-crossing axons are initially Robo-positive. Midline Robo expression later disappears, but is strongly upregulated in longitudinally running postcrossing axons. PMID: 14689480
Robo1 single mutants show guidance defects that reveal a role for this receptor in guiding commissural axons to different positions within the ventral and lateral funiculi. PMID: 15091338
Slit-2 and Robo-1 expression is present throughout mesenchyme at midgestation and is not detectable by newborn day 1 PMID: 15162513
Dutt1/Robo1 is a classic tumor suppressor gene requiring inactivation of both alleles to elicit lung tumorigenesis in these mice. PMID: 15374951
Robo1 mutants have distinct phenotypes, some of which are different from those described in Slit mutants PMID: 16690755
Robo1 protein directly mediates the repulsive activity of Slit receptors on lateral olfactory tract axons, and is required for normal guidance of these axons in vivo. PMID: 17360927
Our results demonstrate that Robo1 and Robo2 mostly cooperate to mediate the function of Slit proteins in guiding the major forebrain projections. PMID: 17392456
This study shows distinct expression patterns for the Dutt1 and Robo1 alternative promoters in the embryonic nervous system. PMID: 17826360
The role of Slit-Robo1 signaling in the generation, migration and morphological differentiation of cortical interneurons is reported. PMID: 18054781
Robo1 and Robo2 cooperate to prevent premature midline crossing points in the visual pathway of developing brain; Robo1 plays a minor role in retinal ganglion cell targeting. PMID: 18272390
Robo1 and Robo2 cooperate with Slit1 and Slit2 to control the convergence ofolfactory receptor neuron (ORN) axons to the olfactory bulb and the precise targeting of ORN axons to specific glomeruli. PMID: 18417704
Robo1 and Robo2 were largely genetically redundant, and neither appeared to specify specific tract positions. However, combined Robo1 and Robo2 mutations strongly disrupted each pioneer tract. PMID: 18842816
Data show that cerebellofugal axons tend to stall within the midline region in Robo1/2 double knockout mice. PMID: 18986510

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.