Recombinant Mouse Robo1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10074P
Recombinant Mouse Robo1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10074P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | O89026 |
Synonym | Deleted in U twenty twenty DUTT 1 DUTT1 FLJ21882 H Robo 1 H-Robo-1 hRobo 1 Robo 1 Robo1 ROBO1_HUMAN Roundabout 1 Roundabout axon guidance receptor homolog 1 Roundabout homolog 1 Roundabout homolog1 precurser Roundabout1 SAX 3 SAX3 |
Description | Recombinant Mouse Robo1 Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | YRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNIS EPATQPWLADTWPNTGNNHNDCSINCCTAGNGNSDSNLTTYSRPADCIAN YNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSG QPTPYATTQLIQANLSNNMNNGAGDSSEKHWKPPGQQKPEVAPIQYNIME QNKLNKDYRANDTIPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKG ARTPKAPKQGGMNWADLLPPPPAHPPPHSNSEEYNMSVDESYDQEMPCPV PPAPMYLQQDELQEEEDERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQ EELQPMLQDCPEDLGHMPHPPDRRRQPVSPPPPPRPISPPHTYGYISGPL VSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTG SMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKV ARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAVVIQKARPAKKQKHQP GHLRREAYADDLPPPPVPPPAIKSPTVQSKAQLEVRPVMVPKLASIEART DRSSDRKGGSYKGREALDGRQVTDLRTNPSDPREAQEQPNDGKGRGTRQP KRDLPPAKTHLGQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQRE QANVGRRNMAEMQVLGGFERGDENNEELEETES |
Molecular Weight | 181 kDa |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Receptor for SLIT1 and SLIT2 that mediates cellular responses to molecular guidance cues in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. Interaction with the intracellular domain of FLRT3 mediates axon attraction towards cells expressing NTN1. In axon growth cones, the silencing of the attractive effect of NTN1 by SLIT2 may require the formation of a ROBO1-DCC complex. Plays a role in the regulation of cell migration via its interaction with MYO9B; inhibits MYO9B-mediated stimulation of RHOA GTPase activity, and thereby leads to increased levels of active, GTP-bound RHOA. May be required for lung development. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass membrane protein. |
Protein Families | Immunoglobulin superfamily, ROBO family |
Database References | |
Tissue Specificity | Detected in embryonic thalamus neurons (at protein level). Expressed in embryonal spinal chord. Expressed in embryonal lung, and in adult lung bronchial epithelial cells of large proximal airways. |
Gene Functions References
- Low Robo1 expression is associated with developmental defects of cranial frontal and parietal bones. PMID: 28987541
- Contralateral migration of oculomotor neurons is regulated by Slit/Robo signaling. Results demonstrate that a migratory subset of motor neurons respond to floor plate-derived Slit repulsion to properly control the timing of contralateral migration. PMID: 27770832
- While Slit1 and Robo2 are only expressed in peripheral axons and their cell bodies, Slit2, Slit3 and Robo1 are also expressed in satellite cells of the dorsal root ganglion, Schwann cells and fibroblasts of peripheral nerves. PMID: 28234971
- restoration of miR-218 inhibited retinal angiogenesis via targeting Robo1. MiR-218 contributed to the inhibition of retinal angiogenesis and miR-218 might be a new therapeutic target for preventing retinal neovascularization.. PMID: 26960375
- Robo1-Slit2 interaction required for pathfinding mechanism essential to establish the functionally important habenulo-interpeduncular connection. PMID: 25366972
- FLRT3 is a Robo1 coreceptor in developing axons. PMID: 24560577
- Slit2/Robo1 signaling promotes intestinal tumorigenesis through Src-mediated activation of the Wnt/beta-catenin pathway. PMID: 25605242
- Robo1/2 regulate follicle atresia through manipulating granulosa cell apoptosis in mice PMID: 25988316
- Roundabout receptor (Robo) genes are expressed in pulmonary neuroendocrine cells (PNECs), a rare, innervated epithelial population. Robo inactivation in mouse lung results in an inability of PNECs to cluster into sensory organoids and triggers increased neuropeptide production upon exposure to air. PMID: 26743624
- Cardiac defects in mutants for Robo or Slit range from membranous ventricular septum defects to bicuspid aortic valves. PMID: 25691540
- Slit2 signaling through Robo1 and Robo2 has a role in retinal neovascularization PMID: 25894826
- This study demonistrated that significant increase of interneurons in the cortices of Robo1-/- mice, implicate Robo1 in the regulation of progenitor cell dynamics in the developing forebrain. PMID: 24741061
- we report that Robo1 plays an important role in guiding olfactory sensory neurons in the mouse olfactory system during development. PMID: 23821580
- SDF-1-CXCR4 differentially regulates autoimmune diabetogenic T cell adhesion through ROBO1-SLIT2 interactions in mice. PMID: 23811810
- These results demonstrate that Robo receptors play a crucial role in neocortical lamination and particularly in the positioning of layers II/III pyramidal neurons. PMID: 22661412
- During stroke recovery, a transient reduction in Robo1 expression on the cerebral endothelial cells allowed the uncontrolled infiltration of polymorphonuclear neutrophils into the brain causing inflammatory reactions PMID: 23473743
- Prostaglandin F2alpha upregulates Slit2 and Robo1 expression in mouse corpus luteum during luteolysis. PMID: 23814012
- Slit/Robo signaling imposes a restriction force on spiral ganglia neurons to ensure their precise positioning for correct spiral ganglia-cochlear hair cells innervations. PMID: 23884932
- Slit/Robo1 signaling is involved in regulating neural tube development by tightly coordinating cell proliferation and differentiation during neurulation. PMID: 23438940
- Report role of Robo1 in development of the caval veins and pericardium. PMID: 23255421
- Inactivation of Robo 1 leads to mispositioning of the stomach in the thoracic instead of the abdominal cavity, which likely contributes to poor lung inflation and lethality at birth, reminiscent of congenital diaphragmatic hernia. PMID: 23328398
- This study report that central nervous system progenitors express Robo1 and Robo2, receptors for Slit proteins that regulate axon guidance, and that absence of these receptors or their ligands leads to loss of ventricular mitoses. PMID: 23083737
- Modifications to spontaneous calcium activity encode a switch in the axon outgrowth program that allows establishment of specific neuronal connections through the transcriptional regulation of Slit1 and Robo1 signaling. PMID: 22772332
- Robo1 and Robo2 are expressed in the nucleus origin of the tract of the postoptic commissure TPOC (nTPOC), while Slit expression domains flank the TPOC trajectory. PMID: 21688288
- Robo1 is the predominant receptor for guiding axons in ventral tracts and prevents midline crossing. PMID: 21820427
- Axons in the enlarged ventral funiculus of the srGAP3 KO are Robo1 positive but do not express Robo2, indicating that the thickening of the ventral funiculus in the srGAP3 KO is not a Robo2 mediated effect. PMID: 21655271
- These results indicate that Slit1/2 - Robo1/2 signaling is critical during the initial establishment of dopaminergic pathways, with roles in the dorsoventral positioning and precise pathfinding of these ascending longitudinal axons. PMID: 21118670
- During blood vessel formation microRNA-218 inhibits the expression of Robo1 (and that of Robo2) and thus the heparan sulfate biosynthetic pathway. PMID: 20947829
- Robo1 prevents axonal stalling after crossing the floor plate at the spinal cord ventral midline PMID: 20631173
- Robo1 inhibits choroidal and retinal angiogenesis in vitro. Robo1 is a potential target for the treatment of choroidal or retinal angiogenesis. PMID: 19958120
- Dutt1/Robo1 expression was widespread and diffuse in the lung at embryonic day 17.5 but became increasingly localised to the bronchial epithelium in newborn and adult mice. PMID: 12123796
- activation of the transmembrane receptor Activation of Roundabout (Robo) by its ligand, the secreted repulsive guidance cue Slit, inactivates N-cadherin-mediated cell adhesion in CNS growth cones. PMID: 12360290
- Data suggest that the Slit family of axon guidance molecules (Slit 1-3) and their Robo 1 and 2 receptors contribute to the topographic targeting of basal vomeronasal axons. PMID: 12954717
- In the spinal cord, midline-crossing axons are initially Robo-positive. Midline Robo expression later disappears, but is strongly upregulated in longitudinally running postcrossing axons. PMID: 14689480
- Robo1 single mutants show guidance defects that reveal a role for this receptor in guiding commissural axons to different positions within the ventral and lateral funiculi. PMID: 15091338
- Slit-2 and Robo-1 expression is present throughout mesenchyme at midgestation and is not detectable by newborn day 1 PMID: 15162513
- Dutt1/Robo1 is a classic tumor suppressor gene requiring inactivation of both alleles to elicit lung tumorigenesis in these mice. PMID: 15374951
- Robo1 mutants have distinct phenotypes, some of which are different from those described in Slit mutants PMID: 16690755
- Robo1 protein directly mediates the repulsive activity of Slit receptors on lateral olfactory tract axons, and is required for normal guidance of these axons in vivo. PMID: 17360927
- Our results demonstrate that Robo1 and Robo2 mostly cooperate to mediate the function of Slit proteins in guiding the major forebrain projections. PMID: 17392456
- This study shows distinct expression patterns for the Dutt1 and Robo1 alternative promoters in the embryonic nervous system. PMID: 17826360
- The role of Slit-Robo1 signaling in the generation, migration and morphological differentiation of cortical interneurons is reported. PMID: 18054781
- Robo1 and Robo2 cooperate to prevent premature midline crossing points in the visual pathway of developing brain; Robo1 plays a minor role in retinal ganglion cell targeting. PMID: 18272390
- Robo1 and Robo2 cooperate with Slit1 and Slit2 to control the convergence ofolfactory receptor neuron (ORN) axons to the olfactory bulb and the precise targeting of ORN axons to specific glomeruli. PMID: 18417704
- Robo1 and Robo2 were largely genetically redundant, and neither appeared to specify specific tract positions. However, combined Robo1 and Robo2 mutations strongly disrupted each pioneer tract. PMID: 18842816
- Data show that cerebellofugal axons tend to stall within the midline region in Robo1/2 double knockout mice. PMID: 18986510