Recombinant Mouse RIP Protein

Beta LifeScience SKU/CAT #: BLA-10072P
Recombinant Mouse RIP Protein

Recombinant Mouse RIP Protein

Beta LifeScience SKU/CAT #: BLA-10072P
Catalog No.: BLA-10072P

Product Overview

Host Species Mouse
Accession Q60855
Synonym Cell death protein RIP FLJ39204 OTTHUMP00000039163 Receptor (TNFRSF) interacting serine threonine kinase 1 Receptor interacting protein receptor interacting protein 1 Receptor interacting protein kinase 1 Receptor interacting serine threonine protein kinase 1 Receptor TNFRSF interacting serine threonine kinase 1 Receptor-interacting protein 1 Receptor-interacting serine/threonine-protein kinase 1 Rinp RIP RIP 1 Rip-1 RIP1 RIPK 1 Ripk1 RIPK1_HUMAN Serine threonine protein kinase RIP Serine/threonine-protein kinase RIP
Description Recombinant Mouse RIP Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTG PNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNL MHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDF HIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLN DINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNV EEILEYCPREIISLMERCWQAIPEDRPTFLGIEEEFRPFYLSHFEEYVEE DVASLKKEYPDQSPVLQRMFSLQHDCV
Purity >70% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific activity ofthis protein was1.8 nmol/min/mg in akinase assay usingMBP proteinas substrate.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed