Recombinant Mouse Renalase Protein (His tag)

Name: Recombinant Mouse Renalase Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-10071P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	A7RDN6
Synonym	6530404N21Rik AI452315 AW060440 C10orf59 Chromosome 10 open reading frame 59 FLJ11218 HGNC:25641 Hypothetical protein LOC55328 MAO C MAO-C mMAO C Monoamine oxidase C Monoamine oxidase-C Renalase Renalase FAD dependent amine oxidase RNLS RNLS_HUMAN
Description	Recombinant Mouse Renalase Protein (His tag) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	ALLRKEITAPLYLGLWDKGGDIGGRMITASSPHNPRCTADLGAQYITCSP HYVKEHQNFYEELLAHGILKPLTSPIEGMKGKEGDCNFVAPQGFSSVIKY YLKKSGAEVSLKHCVTQIHLKDNKWEVSTDTGSAEQFDLVILTMPAPQIL ELQGDIVNLISERQREQLKSVSYSSRYALGLFYEVGMKIGVPWSCRYLSS HPCICFISIDNKKRNIESSECGPSVVIQTTVPFGVQHLEASEADVQKLMI QQLETILPGLPQPVATICHKWTYSQVTSSVSDRPGQMTLHLKPFLVCGGD GFTHSNFNGCISSALSVMKVLKRYI
Molecular Weight	52 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Catalyzes the oxidation of the less abundant 1,2-dihydro-beta-NAD(P) and 1,6-dihydro-beta-NAD(P) to form beta-NAD(P)(+). The enzyme hormone is secreted by the kidney, and circulates in blood and modulates cardiac function and systemic blood pressure. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.
Subcellular Location	Secreted.
Protein Families	Renalase family
Database References	KEGG: mmu:67795 STRING: 10090.ENSMUSP00000093825 UniGene: Mm.204591
Tissue Specificity	Expressed predominantly in kidney and testis with lower levels in liver, heart and embryo and weak expression in brain and skeletal muscle.

Gene Functions References

Data (including data from studies in knockout mice) suggest that renalase functions as a protective plasma protein that reduces pancreatic acinar cell injury and prevents pancreatitis via interactions with plasma membrane calcium ATPase Pmca4b. PMID: 29042438
High RNLS expression is associated with melanoma. PMID: 27197188
revealed renalase as a novel target gene of HIF-1alpha in protection against myocardial ischaemia/reperfusion injury PMID: 25497549
Renalase promotes cell survival and protects against renal injury in mice through the activation of intracellular signaling cascades, independent of its ability to metabolize catecholamines. PMID: 24511138
Renalase is wildly expressed in kidney, including glomeruli, tubule, mesangial cells, podocytes and tubule epithelial cells, and may be secreted by tubule epithelial cells primarily PMID: 23056310
the identification of a renalase homologue from mouse, termed mMAO-C (mouse monoamine oxidase-C) after the monoamine oxidase-A and -B (MAO-A and -B PMID: 17846919

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.