Name: Recombinant Mouse RELM Gamma Protein
Brand: Beta LifeScience
SKU: BLA-10069P
Availability: InStock

Catalog No.: BLA-10069P

Host Species	Mouse
Accession	Q7TM98
Synonym	Fizz3 Myeloid cysteine rich protein Resistin like gamma Resistin like molecule gamma Retnlg Xcp1
Description	Recombinant Mouse RELM Gamma Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMT VTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Molecular Weight	19 kDa
Purity	>95% SDS-PAGE.Purity determined by reducing and non-reducing SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.