Recombinant Mouse RELM Gamma Protein (Animal Free) (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-10070P
Recombinant Mouse RELM Gamma Protein (Animal Free) (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-10070P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q7TM98 |
Synonym | Fizz3 Myeloid cysteine rich protein Resistin like gamma Resistin like molecule gamma Retnlg Xcp1 |
Description | Recombinant Mouse RELM Gamma Protein (Animal Free) (Animal Free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMT VTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA |
Molecular Weight | 19 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |