Name: Recombinant Mouse RELM Gamma Protein (Animal Free) (Animal Free)
Brand: Beta LifeScience
SKU: BLA-10070P
Availability: InStock

Catalog No.: BLA-10070P

Host Species	Mouse
Accession	Q7TM98
Synonym	Fizz3 Myeloid cysteine rich protein Resistin like gamma Resistin like molecule gamma Retnlg Xcp1
Description	Recombinant Mouse RELM Gamma Protein (Animal Free) (Animal Free) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMT VTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Molecular Weight	19 kDa
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.