Recombinant Mouse RELM beta Protein
Beta LifeScience
SKU/CAT #: BLA-10068P
Recombinant Mouse RELM beta Protein
Beta LifeScience
SKU/CAT #: BLA-10068P
Catalog No.: BLA-10068P
Product Overview
| Host Species | Mouse |
| Accession | Q99P86 |
| Synonym | C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2 CCGR Colon and small intestine specific cysteine rich protein Colon and small intestine-specific cysteine-rich protein Colon carcinoma related gene protein Colon carcinoma-related gene protein Cysteine rich secreted A12 alpha like protein 1 Cysteine rich secreted protein A12 alpha like 1 Cysteine rich secreted protein FIZZ2 Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 FIZZ1 FIZZ2 Found in inflammatory zone 1 HXCP2 RELM beta RELMb RELMbeta Resistin like beta Resistin like protein beta Resistin-like beta RETNB_HUMAN RETNL2 Retnlb XCP2 |
| Description | Recombinant Mouse RELM beta Protein was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCAC GYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA |
| Molecular Weight | 9 kDa |
| Purity | >95% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at -20°C. |
