Recombinant Mouse RELM beta Protein

Beta LifeScience SKU/CAT #: BLA-10068P
Recombinant Mouse RELM beta Protein

Recombinant Mouse RELM beta Protein

Beta LifeScience SKU/CAT #: BLA-10068P
Catalog No.: BLA-10068P

Product Overview

Host Species Mouse
Accession Q99P86
Synonym C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2 CCGR Colon and small intestine specific cysteine rich protein Colon and small intestine-specific cysteine-rich protein Colon carcinoma related gene protein Colon carcinoma-related gene protein Cysteine rich secreted A12 alpha like protein 1 Cysteine rich secreted protein A12 alpha like 1 Cysteine rich secreted protein FIZZ2 Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 FIZZ1 FIZZ2 Found in inflammatory zone 1 HXCP2 RELM beta RELMb RELMbeta Resistin like beta Resistin like protein beta Resistin-like beta RETNB_HUMAN RETNL2 Retnlb XCP2
Description Recombinant Mouse RELM beta Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCAC GYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
Molecular Weight 9 kDa
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C.
Recently viewed