Recombinant Mouse REG1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10064P
Recombinant Mouse REG1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10064P
Catalog No.: BLA-10064P
Product Overview
| Host Species | Mouse |
| Accession | P43137 |
| Synonym | ICRF Islet cells regeneration factor Islet of Langerhans regenerating protein Lithostathine 1 beta Lithostathine-1-alpha P19 Pancreatic stone protein Pancreatic stone protein 2 Pancreatic thread protein PSP PSPS PSPS1 PSPS2 PTP REG REG 1 beta REG-1-alpha REG1A REG1A_HUMAN REG1B Regenerating islet derived protein 1 beta Regenerating islet-derived protein 1-alpha Regenerating protein I alpha REGL |
| Description | Recombinant Mouse REG1 Protein (His tag) was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYL VSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYK SWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG |
| Molecular Weight | 32 kDa including tags |
| Purity | >90% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
