Recombinant Mouse REG1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10064P

Recombinant Mouse REG1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10064P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession P43137
Synonym ICRF Islet cells regeneration factor Islet of Langerhans regenerating protein Lithostathine 1 beta Lithostathine-1-alpha P19 Pancreatic stone protein Pancreatic stone protein 2 Pancreatic thread protein PSP PSPS PSPS1 PSPS2 PTP REG REG 1 beta REG-1-alpha REG1A REG1A_HUMAN REG1B Regenerating islet derived protein 1 beta Regenerating islet-derived protein 1-alpha Regenerating protein I alpha REGL
Description Recombinant Mouse REG1 Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYL VSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYK SWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
Molecular Weight 32 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Might act as an inhibitor of spontaneous calcium carbonate precipitation.
Subcellular Location Secreted.
Database References
Tissue Specificity Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver.

Gene Functions References

  1. These results suggest that Reg1, which is released from acinar-like cell clusters touching Langerhans islets with thin interstitial surrounding to islet beta cell clusters, has a crucial role in beta cell regeneration in ncephalomyocarditis virus-induced diabetes. PMID: 29935186
  2. Reg I may play a role in the maintenance of mucosal barrier function by inducing tight junction proteins such as claudins 3 and 4. PMID: 27055226
  3. Members of the Reg gene family show distinct profiles of expression in the GI tract, and Reg I independently plays a role in protecting the GI mucosa against NSAID-induced injury. PMID: 25747353
  4. Regenerating 1 and 3b gene expression in the pancreas of type 2 diabetic Goto-Kakizaki (GK) rats PMID: 24587207
  5. This study implicates the Reg1 pathway in beta-cell regeneration and describes altered programming of gene expression in low protein offspring. PMID: 23986224
  6. Regenerating islet-derived 1alpha (Reg-1alpha) protein is new neuronal secreted factor that stimulates neurite outgrowth via exostosin Tumor-like 3 (EXTL3) receptor. PMID: 22158612
  7. Expression of Reg proteins in embryonic stem cells is modulated by Wnt/beta catenin signaling. PMID: 20050810
  8. Reg I(-/-) mice had a greater number of severe small intestinal lesions after indomethacin administration. Reg I may be useful as a therapeutic agent in NSAID-induced small intestinal injuries. PMID: 20508157
  9. transgenic overexpression of RegI (regenerating protein 1)accelerates the healing of experimental gastric ulcers. PMID: 20157293
  10. RegI and gastrin may synergistically regulate gastric mucosal proliferation during certain pathological settings like wound healing PMID: 19969026
  11. expression of the putative growth factor Reg1 is controlled through separate promoter elements by gastrin and Helicobacter. PMID: 17463184
  12. Demonstrate the presence of RegI in mouse testes. PMID: 18712671

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed