Recombinant Mouse Recoverin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10063P

Recombinant Mouse Recoverin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10063P
Catalog No.: BLA-10063P
Product Overview
Host Species | Mouse |
Accession | P34057 |
Synonym | 23 kDa photoreceptor cell-specific protein Cancer associated retinopathy protein Cancer-associated retinopathy protein CAR CAR protein p26 Protein CAR RCV1 RCVRN RECO_HUMAN Recoverin S-modulin |
Description | Recombinant Mouse Recoverin Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMGNSKSGALSKEILEELQLNTKFTEEE LSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANS DGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVM AIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTL ANKEILRLIQFEPQKVKERIKEKKQ |
Molecular Weight | 26 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle. |