Recombinant Mouse Recoverin Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10063P
Recombinant Mouse Recoverin Protein (His tag)

Recombinant Mouse Recoverin Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10063P
Catalog No.: BLA-10063P

Product Overview

Host Species Mouse
Accession P34057
Synonym 23 kDa photoreceptor cell-specific protein Cancer associated retinopathy protein Cancer-associated retinopathy protein CAR CAR protein p26 Protein CAR RCV1 RCVRN RECO_HUMAN Recoverin S-modulin
Description Recombinant Mouse Recoverin Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMGNSKSGALSKEILEELQLNTKFTEEE LSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANS DGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVM AIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTL ANKEILRLIQFEPQKVKERIKEKKQ
Molecular Weight 26 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed