Recombinant Mouse Recoverin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10063P
Recombinant Mouse Recoverin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10063P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P34057 |
Synonym | 23 kDa photoreceptor cell-specific protein Cancer associated retinopathy protein Cancer-associated retinopathy protein CAR CAR protein p26 Protein CAR RCV1 RCVRN RECO_HUMAN Recoverin S-modulin |
Description | Recombinant Mouse Recoverin Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMGNSKSGALSKEILEELQLNTKFTEEE LSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANS DGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVM AIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTL ANKEILRLIQFEPQKVKERIKEKKQ |
Molecular Weight | 26 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle. |