Recombinant Mouse RAET1E Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10060P
Recombinant Mouse RAET1E Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10060P
Catalog No.: BLA-10060P
Product Overview
| Host Species | Mouse |
| Accession | Q9CZQ6 |
| Synonym | bA350J20.7 LETAL Lymphocyte effector toxicity activation ligand MGC125308 MGC125309 N2DL-4 N2DL4 N2DL4_HUMAN NKG2D ligand 4 NKG2D ligand 4 precursor NKG2DL4 RAE-1-like transcript 4 RAET1E RAET1E2 Retinoic acid early transcript 1E RL-4 |
| Description | Recombinant Mouse RAET1E Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
| Source | Baculovirus infected insect cells |
| AA Sequence | LDDAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDP GKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQ SQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLV QQLKYFIPQCRQKIDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSL EHHHHHH |
| Molecular Weight | 24 kDa including tags |
| Purity | >95% purity as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
