Recombinant Mouse Pyruvate Dehydrogenase E2 Protein
Beta LifeScience
SKU/CAT #: BLA-10050P
Recombinant Mouse Pyruvate Dehydrogenase E2 Protein
Beta LifeScience
SKU/CAT #: BLA-10050P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q8BMF4 |
Synonym | 70 kDa mitochondrial autoantigen of primary biliary cirrhosis Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex Dihydrolipoamide S Acetyltransferase Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex mitochondrial DLAT DLTA E2 E2 component of pyruvate dehydrogenase complex M2 antigen complex 70 kDa subunit mitochondrial ODP2_HUMAN PBC PDC E2 PDC-E2 PDCE2 Pyruvate dehydrogenase complex component E2 Pyruvate dehydrogenase complex E2 subunit |
Description | Recombinant Mouse Pyruvate Dehydrogenase E2 Protein was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | SLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVETDKATVG FESLEECYMAKILVPEGTRDVPVGSIICITVEKPQDIEAFKNYTLDLAAA AAPQAAPAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPALSPTMTMGTVQ RWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPL GAPLCIIVEKQEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPV APTPSAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDID SFVPSKAAPAAAAAMAPPGPRVAPAPAGVFTDIPISNIRRVIAQRLMQSK QTIPHYYLSVDVNMGEVLLVRKELNKMLEGKGKISVNDFIIKASALACLK VPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASD VVSLASKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAI GASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLE KPITMLL |
Molecular Weight | 59 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle. |
Subcellular Location | Mitochondrion matrix. |
Protein Families | 2-oxoacid dehydrogenase family |
Database References |
Gene Functions References
- These data reveal a central role for Dlat in the metabolic program regulated by E4F1 in basal keratinocytes. PMID: 27621431
- On the basis of our ChIP data and these previous findings, we hypothesize that PDC may modulate STAT5's ability to regulate gene expression by controlling histone or STAT5 acetylation PMID: 28982698
- breach of tolerance to PDC-E2 is probably the first event in the natural history of primary biliary cirrhosis in genetically susceptible hosts. PMID: 24128311
- a novel function of pyruvate dehydrogenase complex E2 in the nucleus in up-regulating the transactivating ability of STAT5 PMID: 21397011