Name: Recombinant Mouse PSCA Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-10046P
Availability: InStock

Catalog No.: BLA-10046P

Host Species	Mouse
Accession	P57096
Synonym	PRO 232 PRO232 Prostate stem cell antigen
Description	Recombinant Mouse PSCA Protein (His tag) was expressed in Yeast. It is a Full length protein
Source	Yeast
AA Sequence	LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQC EDDSENYYLGKKNITCCYSDLCNVN
Molecular Weight	10 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.