Recombinant Mouse PRSS22 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10044P
Recombinant Mouse PRSS22 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10044P
Catalog No.: BLA-10044P
Product Overview
| Host Species | Mouse |
| Accession | NP_598492 |
| Synonym | Brain specific serine protease 4 BSSP 4 BSSP4 hBSSP 4 MGC9599 Prosemin Protease serine 22 Protease serine S1 family member 22 PRSS 22 PRSS26 Serine protease 22 Serine protease 26 SP001LA Tryptase epsilon |
| Description | Recombinant Mouse PRSS22 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
| Source | Baculovirus infected insect cells |
| AA Sequence | ATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTN RWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRY SWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGS IQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLE GERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVYTSLLAHR SWVQRIVQGVQLRGYLADSGDTGSSLEHHHHHH |
| Molecular Weight | 31 kDa including tags |
| Purity | >95% purity as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
