Recombinant Mouse Prostaglandin E2 Receptor Ep4 Subtype (PTGER4)

Beta LifeScience SKU/CAT #: BLC-07213P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Prostaglandin E2 Receptor Ep4 Subtype (PTGER4)

Beta LifeScience SKU/CAT #: BLC-07213P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Prostaglandin E2 Receptor Ep4 Subtype (PTGER4) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P32240
Target Symbol PTGER4
Species Mus musculus (Mouse)
Expression System E.coli
Tag Tag-Free
Target Protein Sequence RKTVLSKAIEKIKCLFCRIGGSGRDSSAQHCSESRRTSSAMSGHSRSFLARELKEISSTSQTLLYLPDLTESSLGGRNLLPGSHGMGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSHREEPASKGNSLQVTFPSETLKLSEKCI
Expression Range 361-513aa
Protein Length Partial
Mol. Weight 16.6 kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Database References

KEGG: mmu:19219

STRING: 10090.ENSMUSP00000048736

UniGene: PMID: 29890224

  • Paricalcitol also attenuated the infiltration of inflammatory cells and production of proinflammatory cytokines after IR injury. EP4 antagonist abolished these antioxidant, anti-inflammatory, and antiapoptotic effects. The EP4 plays a pivotal role in the protective effects of paricalcitol in renal IR injury. PMID: 28465762
  • These results demonstrate a novel role for prostaglandin receptor EP4 in the mediation of barrier-enhancing and anti-inflammatory effects caused by oxidized phospholipids. PMID: 28572443
  • The deletion of EP4 increases mitochondrial biogenesis and oxidative capacity in WAT, and fat mass loss ensues in mice. PMID: 28533326
  • Myeloid cell Ptger4 modulates interleukin production but not atherogenesis in type I diabetic mice. PMID: 27351842
  • These data suggest that vascular EP4 receptors buffer the actions of AngII on renal hemodynamics and oxidative injury. PMID: 27245461
  • these studies have demonstrated an important but unexpected role for macrophage COX-2/prostaglandin E2/PGE2 receptor subtype 4 signaling to lessen progression of diabetic kidney disease, unlike the pathogenic effects of increased COX-2 expression in intrinsic renal cells. PMID: 27815317
  • It mediates neuritogenesis in sensory neuron. PMID: 27032908
  • PGE2-mediated EP4 signaling in myeloid cells promotes tumorigenesis. PMID: 26378024
  • the lean phenotype of EP4-deficient mice resulted from reduction in adipose tissue and accretion of other peripheral organs caused by impaired triglyceride clearance PMID: 26271253
  • These findings suggest that systemic EP4 antagonism leads to increased adhesion formation and matrix deposition during flexor tendon healing. PMID: 26312751
  • These data suggest that EPRAP in macrophages functions crucially in suppressing colonic inflammation. Consistently, EPRAP-positive macrophages were also accumulated in the colonic stroma of ulcerative colitis patients. PMID: 26439841
  • an EP4 receptor antagonist modulated PGE2 effects on fibroblast production of angiogenic factors PMID: 26475855
  • LPS-induced non-REM sleep was slightly attenuated in mice lacking EP4 receptors in the nervous system PMID: 25532785
  • Data suggest that the ability of prostaglandin E2 receptor EP4 to promote aquaporin 2 (AQP2) membrane targeting and increase AQP2 abundance makes it a therapeutic target for the treatment of congenital diabetes insipidus. PMID: 26100911
  • Data suggest that PGE2/Ep4 (prostaglandin E receptor 4; Ptger4) signaling via cAMP/Epac (exchange protein directly activated by cAMP 1; Rapgef3) induces expression of Icam1 (intercellular adhesion molecule 1) in cerebrovascular endothelial cells. PMID: 23317035
  • these studies support the hypothesis that EP4-mediated activation can, in an autocrine or paracrine manner drive stem cell survival. PMID: 24281828
  • Selective activation of the EP4 receptor following acute ischemic damage is neuroprotective. PMID: 23041537
  • EP4 is a key receptor for PGE(2)-mediated direct and indirect regulation of hematopoietic stem/progenitor cells. PMID: 23315170
  • different EP receptors (EP(1-4)) to PGE(2)-induced anion secretion in human and mouse colon mucosa PMID: 22732652
  • low dietary salt intake induces expression of COX-2 followed by enhanced renal PGE(2) synthesis, which stimulates the renin-angiotensin-aldosterone system by activation of EP4 receptor. PMID: 22993066
  • An endogenous PGE(2)-EP(4) system in the tubular epithelium limits the development of tubulointerstitial fibrosis by suppressing inflammatory responses. PMID: 22513820
  • EP4-MS pretreatment, but not unloaded ONO-AE2-724, significantly attenuated TNBS-induced colitis. PMID: 22300734
  • The genome wide expression analysis of full term wild type and EP4(-/-) DA indicates that PGE(2)/EP4 signaling modulates expression of a number of unique pathways. PMID: 22342504
  • These findings suggest that EP4 signaling is necessary for the maintenance of cochlear physiological function and for cochlear protection against noise-induced damage PMID: 22198478
  • MMP-dependent release of TNFalpha induced expression of early growth response protein 1 in macrophages followed by elevation in mPGES-1 expression; induction of mPGES-1 was regulated in part through positive feedback loop dependent on PGE2 binding to EP4 PMID: 22227567
  • Expression of EP4 was robust in neurons and markedly induced in endothelial cells after ischemia-reperfusion, suggesting that neuronal and/or endothelial EP4 signaling imparts cerebroprotection. PMID: 21965326
  • study provides novel evidence that mesenchymal stem cell (MSC)-derived PGE2 is highly induced in Th17-MSC co-cultures and mediates a potent suppressive effect on primary and secondary Th17 induction via the EP4 receptor PMID: 21710489
  • in advanced atherosclerosis, EP4 deficiency did not alter atherosclerotic lesion size, but yielded plaques with exacerbated inflammation and altered lesion composition PMID: 20736236
  • Deficiency of EP4 on bone marrow-derived cells boosted inflammation and abdominal aortic aneurysm formation induced by angiotensin II in hyperlipidemic mice. PMID: 21088251
  • Conditional deletion of this prostanoid receptor subtype from podocytes confers partial protection from glomerular filtration barrier damage after 5/6 nephrectomy. PMID: 20671216
  • This study supports an analogous and beneficial effect of PGE2 EP4 receptor signaling in suppressing brain inflammation PMID: 20483760
  • The present results address the novel activities of COX-2/PGE2-EP3/EP4 signaling that modulate tumor biology and show that CXCL12/CXCR4 axis may play a crucial role in tumor stromal formation and angiogenesis under the control of prostaglandins. PMID: 20110411
  • EP4 knockdown in cardiac myocytes in aged male KO mice is in part associated with increased fibrosis, reduced ejection fraction, and dilated cardiomyopathy. PMID: 20008274
  • Effects of selective prostaglandin EP4 receptor antagonist on osteoclast formation and bone resorption in vitro. PMID: 11792579
  • the EP4-receptor appears to be physiologically relevant in Kupffer cells since it conferred a high affinity response to PGE2. PMID: 11867175
  • EP4 maintains intestinal homeostasis by keeping mucosal integrity and downregulating immune response. PMID: 11927615
  • role of EP4 in progression of rheumatoid arthritis PMID: 12208866
  • Data show that although Langerhans cells express all four prostaglandin E receptor subtypes, their migration to regional lymph nodes was decreased only in receptor subtype 4 (EP4)-deficient mice and in wild-type mice treated with an EP4 antagonist. PMID: 12740571
  • combined effects of EP(1) and EP(4) antagonists on spontaneous polyp formation in APC knockout mice. PMID: 12841871
  • Disruption of the EP4 gene in bone marrow cells abrogates osteoclast formation in cocultures of cancer cell lines with bone marrow cells from COX-2 knockout (-/-), EP2 -/- or EP4 -/- mice compared to wild-type mice. PMID: 14623055
  • EP4 and COX-2 mRNA increased three- and sevenfold in stretched podocytes PMID: 14665434
  • Results describe the role of prostaglandin E(2) and its receptor EP4 in cell proliferation. PMID: 15123663
  • PGE(2) inhibits a crucial step of the adipocyte differentiation process by acting on the EP4 receptor in 3T3-L1 cells. PMID: 15336550
  • EP4 receptor mediates the suppressive action of PGE(2) in 3T3-L1 adipocyte differentiation. PMID: 15336573
  • Mice homozygous for the targeted allele or following its Cre-mediated deletion die within hours of birth with persistent patent ductus areteriosus. PMID: 15354288
  • Inhibitory role of EP4 PGE(2) receptor in hepatic ischemic reperfusoin injury and the therapeutic efficacy of a selective EP4 agonist for liver protection. PMID: 15808664
  • Data obtained from EP4 receptor knockout mice demonstrate that the absence of the EP4 receptor decreases bone mass and impairs fracture healing in aged male mice. PMID: 15869929
  • PGE2-EP4 signaling pathway has an inhibitory role in hepatic ischemia reperfusion injury. PMID: 16108069
  • CP432, a nonprostanoid EP4 receptor selective prostaglandin E2 agonist, completely restored trabecular and cortical bone mass and strength in established osteopenic, aged OVX rats by stimulating bone formation and inhibiting bone resorption PMID: 16598377

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Sale
    SDS-PAGE analysis of Human USP9X (Ubiquitin Carboxyl-Terminal Hydrolase 9X) - Recombinant Protein, CAT# BLT-07739P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human USP9X (Ubiquitin Carboxyl-Terminal Hydrolase 9X) - Recombinant Protein
    • Molecule: USP9X;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-GST;
    • Sequence: 1554-1995aa;
    CAT#: BLT-07739P

    Save $139
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $139
    Sale
    SDS-PAGE analysis of Human TRIM21 (E3 Ubiquitin-Protein Ligase Trim21) - Recombinant Protein, CAT# BLT-07371P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human TRIM21 (E3 Ubiquitin-Protein Ligase Trim21) - Recombinant Protein
    • Molecule: TRIM21;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 268-465aa;
    CAT#: BLT-07371P

    Save $139
    Sale
    SDS-PAGE analysis of Human RECK (Reversion-Inducing Cysteine-Rich Protein With Kazal Motifs) - Recombinant Protein, CAT# BLT-08901P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human RECK (Reversion-Inducing Cysteine-Rich Protein With Kazal Motifs) - Recombinant Protein
    • Molecule: RECK;
    • Species: Human;
    • Expression system: Mammalian Cell;
    • Tag: C-6His;
    • Sequence: 27-941;
    CAT#: BLT-08901P

    Save $139
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $139
    Recently viewed