Recombinant Mouse Prokineticin 2/PK2 Protein

Beta LifeScience SKU/CAT #: BLA-10039P
Recombinant Mouse Prokineticin 2/PK2 Protein

Recombinant Mouse Prokineticin 2/PK2 Protein

Beta LifeScience SKU/CAT #: BLA-10039P
Catalog No.: BLA-10039P

Product Overview

Host Species Mouse
Accession Q9QXU7
Synonym BV8 Bv8 homolog MIT1 PK2 PROK2 PROK2_HUMAN Prokineticin-2 Protein Bv8 homolog
Description Recombinant Mouse Prokineticin 2/PK2 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHV ANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLA RK
Molecular Weight 12 kDa
Purity >95% SDS-PAGE.Greater than 95% by HPLC analysis.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
More from Beta LifeScience
More from Other Recombinant Proteins
Recombinant Human TSHR Protein (His Tag)
- Baculovirus-Insect Cells - His - Human - Other Recombinant Proteins - TSHR

Online Inquiry
Recombinant Human PTH1R Protein (His Tag)
- HEK293 - His - Human - Other Recombinant Proteins - PTH1R

Online Inquiry
Recombinant Human PTH / Parathyroid Hormone Protein (Fc Tag)
- Fc - HEK293 - Human - Other Recombinant Proteins - Parathyroid Hormone - PTH

Online Inquiry
Recombinant Human FSH Beta Protein (His Tag)
- FSH Beta - HEK293 - His - Human - Other Recombinant Proteins

Online Inquiry
Recombinant Human FSH Beta Protein (Fc Tag)
- Fc - FSH Beta - HEK293 - Human - Other Recombinant Proteins

Online Inquiry
Recombinant Human CGA & FSHB Heterodimer Protein (Fc Tag)
- CGA & FSHB Heterodimer - Fc - HEK293 - Human - Other Recombinant Proteins

Online Inquiry
Recently viewed