Name: Recombinant Mouse Prealbumin Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10036P
Availability: InStock

Catalog No.: BLA-10036P

Host Species	Mouse
Accession	P07309
Synonym	Amyloid polyneuropathy Amyloidosis I ATTR Carpal tunnel syndrome 1 CTS CTS1 Dysprealbuminemic euthyroidal hyperthyroxinemia Dystransthyretinemic hyperthyroxinemia Epididymis luminal protein 111 HEL111 HsT2651 PALB Prealbumin Prealbumin amyloidosis type I Prealbumin Thyroxine-binding Senile systemic amyloidosis TBPA Thyroxine binding prealbumin Transthyretin TTHY_HUMAN TTR TTR protein
Description	Recombinant Mouse Prealbumin Protein (Tagged) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAES GELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGH RHYTIAALLSPYSYSTTAVVSNPQN
Molecular Weight	41 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.