Recombinant Mouse Podoplanin / gp36 Protein
Beta LifeScience
SKU/CAT #: BLA-10032P
Recombinant Mouse Podoplanin / gp36 Protein
Beta LifeScience
SKU/CAT #: BLA-10032P
Catalog No.: BLA-10032P
Product Overview
| Host Species | Mouse |
| Accession | Q62011 |
| Synonym | Aggrus Glycoprotein 36 KD Glycoprotein 36 gp 36 GP 38 GP 40 gp36 GP38 GP40 HT1A 1 HT1A1 hT1alpha 1 hT1alpha 2 hT1alpha1 hT1alpha2 Lung type I cell membrane associated glycoprotein Lung type I cell membrane associated glycoprotein isoform a Lung type I cell membrane associated glycoprotein T1A 2 OTS 8 OTS8 OTTHUMP00000009640 OTTHUMP00000044504 PA2.26 PA2.26 antigen Pdpn PDPN_HUMAN Podoplanin PSEC0003 PSEC0025 T1 alpha T1 ALPHA GENE T1-alpha T1A T1A 2 TI1A TIA 2 TIA2 |
| Description | Recombinant Mouse Podoplanin / gp36 Protein was expressed in E.coli. It is a Protein fragment |
| Source | E.coli |
| AA Sequence | GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQ RERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDN AGDETQTTDKKDGLPVVTLEHHHHHH |
| Molecular Weight | 13 kDa including tags |
| Purity | >98% SDS-PAGE.Purity is > 98% by SDS-PAGE and silver stain. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. The lyo |
