Name: Recombinant Mouse PLGF Protein
Brand: Beta LifeScience
SKU: BLA-10029P
Availability: InStock

Catalog No.: BLA-10029P

Host Species	Mouse
Accession	P49764
Synonym	D12S1900 Pgf PGFL PIGF Placenta growth factor Placental growth factor Placental growth factor, vascular endothelial growth factor related protein PlGF PlGF 2 PLGF_HUMAN PlGF2 SHGC 10760
Description	Recombinant Mouse PLGF Protein was expressed in Insect cells. It is a Protein fragment
Source	Insect cells
AA Sequence	AGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLL SRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCE CRPILETTKAERRKTKGKRKRSRNSQTEEPHPHHHHHH
Molecular Weight	16 kDa including tags
Purity	>85% purity as determined by SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.