Name: Recombinant Mouse PLET1 Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10028P
Availability: InStock

Catalog No.: BLA-10028P

Host Species	Mouse
Accession	Q8VEN2
Synonym	C11orf34 Chromosome 11 open reading frame 34 OTTHUMP00000235436 Placenta expressed transcript 1 Placenta-expressed transcript 1 protein PLET1 PLET1_HUMAN
Description	Recombinant Mouse PLET1 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	SDNGSCVVLDNIYTSDILEISTMANVSGGDVTYTVTVPVNDSVSAVILKA VKEDDSPVGTWSGTYEKCNDSSVYYNLTSQSQSVFQTNWTVPTSEDVTKV NLQVLIVVNRTASKSSVKMEQVQPSASTPIPESSETSQTINTTPTVNTAK TTAKDTANTTAVTTANTTANTTAVTTAKTTAKSLAIRTLGS
Molecular Weight	36 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.