Recombinant Mouse PLET1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10028P
Recombinant Mouse PLET1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10028P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q8VEN2 |
Synonym | C11orf34 Chromosome 11 open reading frame 34 OTTHUMP00000235436 Placenta expressed transcript 1 Placenta-expressed transcript 1 protein PLET1 PLET1_HUMAN |
Description | Recombinant Mouse PLET1 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | SDNGSCVVLDNIYTSDILEISTMANVSGGDVTYTVTVPVNDSVSAVILKA VKEDDSPVGTWSGTYEKCNDSSVYYNLTSQSQSVFQTNWTVPTSEDVTKV NLQVLIVVNRTASKSSVKMEQVQPSASTPIPESSETSQTINTTPTVNTAK TTAKDTANTTAVTTANTTANTTAVTTAKTTAKSLAIRTLGS |
Molecular Weight | 36 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle. |
Subcellular Location | Apical cell membrane; Lipid-anchor, GPI-anchor. Note=Localized at the apical membrane of the most differentiated keratinocytes of the outer root sheath (ORS), clustered mainly in planar regions of the plasma membrane at the base of microvilli. |
Database References | |
Tissue Specificity | Present in hair follicle cells and sebaceous gland of skin, ciliated epithelial cells of trachea and bronchial tube, striated portion of submandibular gland, distal convoluted tubule cells of kidney, ciliated epithelial cells of oviduct, medulla of adrena |
Gene Functions References
- The endogenous dynamics of Plet1 expression establish important patterning cues within the trophoblast compartment by promoting differentiation towards the syncytiotrophoblast or giant cell pathway in Plet1-low and Plet1-high cells, respectively. PMID: 27121762
- these results show that IL-17A-induced PLET1 expression contributes to tissue repair and colon tumorigenesis PMID: 29070673
- The restricted localization in both differentiated outer root sheath and companion layer cells contacting the hair fiber and epidermal wounds suggests a role for the Plet-1 protein in regulating the interaction of keratinocytes with inert tissues. PMID: 20130590
- Plet-1 will thus provide an invaluable tool for genetic analysis of the lineage relationships and molecular mechanisms operating in the development, homeostasis, and injury in several organ/tissue systems PMID: 18195351