Recombinant Mouse PLA2G5 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10025P

Recombinant Mouse PLA2G5 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10025P
Catalog No.: BLA-10025P
Product Overview
Host Species | Mouse |
Accession | P97391 |
Synonym | Ca2+ dependent phospholipase A2 Calcium dependent phospholipase A2 Calcium-dependent phospholipase A2 DKFZp686C2294 FRFB Group V phospholipase A2 GV PLA2 gVPLA2 hVPLA(2) MGC46205 OTTHUMP00000044655 PA2G5_HUMAN Phosphatidylcholine 2 acylhydrolase Phosphatidylcholine 2-acylhydrolase 5 Phospholipase A2 group V PLA2 10 PLA2 G5 PLA2-10 Pla2g5 sPLA2 Type V |
Description | Recombinant Mouse PLA2G5 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRC YGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRR NLWTYNPLYQYYPNFLC |
Molecular Weight | 16 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |