Recombinant Mouse PLA2G5 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-10025P

Recombinant Mouse PLA2G5 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-10025P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession P97391
Synonym Ca2+ dependent phospholipase A2 Calcium dependent phospholipase A2 Calcium-dependent phospholipase A2 DKFZp686C2294 FRFB Group V phospholipase A2 GV PLA2 gVPLA2 hVPLA(2) MGC46205 OTTHUMP00000044655 PA2G5_HUMAN Phosphatidylcholine 2 acylhydrolase Phosphatidylcholine 2-acylhydrolase 5 Phospholipase A2 group V PLA2 10 PLA2 G5 PLA2-10 Pla2g5 sPLA2 Type V
Description Recombinant Mouse PLA2G5 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRC YGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRR NLWTYNPLYQYYPNFLC
Molecular Weight 16 kDa
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity), preferentially releasing fatty acyl groups with a low degree of unsaturation such as oleoyl (C18:1) and linoleoyl (C18:2) groups. Hydrolyzes low-density lipoprotein (LDL) phospholipids releasing unsaturated fatty acids that drive macrophage polarization toward an M2 phenotype. May act in an autocrine and paracrine manner. Contributes to lipid remodeling of cellular membranes at different subcellular locations and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of cardiolipin, a major component of the inner membrane of mitochondria and bacterial membranes. Promotes phagocytosis of bacteria in macrophages through production of lysophosphatidylethanolamines. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing the phospholipids of the bacterial membrane. Promotes phagocytosis and killing of ingested fungi likely through controlling phagosome-lysosome fusion and phagosome maturation. Plays a role in biosynthesis of cysteinyl leukotrienes (CysLTs) in myeloid cells. In eosinophils, triggers perinuclear arachidonate release and LTC4 synthesis in a PLA2G4A-independent way. In neutrophils, amplifies CysLTs biosynthesis initiated by PLA2G4A. Promotes immune complex clearance in macrophages via stimulating synthesis of CysLTs, which act through CYSLTR1 to trigger phagocytosis. May regulate antigen processing in antigen-presenting cells. In pulmonary macrophages regulates IL33 production required for activation of group 2 innate lymphoid cells. May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines.
Subcellular Location Secreted. Cell membrane. Cytoplasmic vesicle, phagosome. Recycling endosome. Golgi apparatus, cis-Golgi network. Golgi apparatus, trans-Golgi network.
Protein Families Phospholipase A2 family
Database References
Tissue Specificity Expressed in peritoneal macrophages (at protein level). Expressed in heart, skeletal muscle and white adipose tissue.

Gene Functions References

  1. macrophage-associated Pla2g5 contributes significantly to type-2 immunity through regulation of IL-33 induction and free fatty acids-driven group 2 innate lymphoid cell activation PMID: 29346348
  2. Deficiency of GV sPLA2 results in diminished glucose-stimulated insulin secretion in isolated pancreatic beta-cells PMID: 28825176
  3. GV sPLA2 is involved in the maintenance of tubular cell function and integrity, promoting sodium retention through increased cortical (Na+ + K+)-ATPase expression and activity. PMID: 26820468
  4. AdPLA2 plays an important role in promoting tumorigenesis and disease progression by modulating the production of prostaglandins and may serve as a potential therapeutic target in TSC and LAM. PMID: 25347447
  5. PLA2G5 hydrolyzed phosphatidylcholine in fat-overladen low-density lipoprotein to release unsaturated fatty acids, which prevented palmitate-induced M1 macrophage polarization. PMID: 24910243
  6. Key Data shows the role of group v secreted phospholipase A2 in Th2 cytokine and dendritic cell-driven airway hyperresponsiveness and remodeling. PMID: 23451035
  7. Our studies identified a unique function of gV-sPLA2 in activation of macrophages PMID: 23650617
  8. The impact of group V sPLA(2) deficiency on angiotensin (Ang) II-induced cardiac fibrosis in apoE deficient mice was investigated. PMID: 22813854
  9. The results indicate that the PLA(2) activity also plays a substantial role in protecting cells against oxidant stress caused by an exogenous hydroperoxide. PMID: 22067043
  10. GV sPLA(2) in bone marrow-derived myeloid cells as well as non-myeloid cells, which are likely bronchial epithelial cells, participate in the regulation of the innate immune response to pulmonary infection with E. coli. PMID: 21849511
  11. Data from cuprizone-induced model of multiple sclerosis suggest that sPLA2 down-regulation during remyelination can limit release of AA and consequent production of pro-inflammatory PGs/TXB2 (which are increased during demyelination). PMID: 21530210
  12. sPLA(2)-V plays an important role in the pathogenesis of myocardial ischemia reperfusion injury partly in concert with the activation of cPLA(2) PMID: 21169294
  13. agonist-induced MAPK activation leads to Prdx6 phosphorylation and translocation to the cell membrane, where its PLA(2) activity facilitates assembly of the NOX2 complex and activation of the oxidase. PMID: 21262967
  14. expression of group V sPLA(2) in antigen-presenting cells regulates Ag processing and maturation of dendritc cells and contributes to pulmonary inflammation and immune response against D. farinae. PMID: 20817863
  15. Demonstrate the role of sPLA(2)-V in lipopolysaccharide-induced ICAM-1 and VCAM-1 protein overexpression and leukocyte recruitment, supporting the contribution of sPLA(2)-V in the development of inflammatory innate immune responses. PMID: 20232296
  16. encapsulation of Group V PLA2 into granules brings the enzyme to the perinuclear envelope during cell activation PMID: 12963740
  17. a role in innate immunity. PMID: 14761945
  18. Group V secretory PLA2 contributes to the innate immune response both through regulation of eicosanoid generation in response to a phagocytic stimulus and also as a component of the phagocytic machinery. PMID: 16407308
  19. group V, but not group X, secreted phospholipase A2 has a role in lung dysfunction PMID: 17008322
  20. Delayed-phase PGD(2) generation and COX-2 induction were reduced approximately 35% in C57BL/6 Pla2g5-/- bone marrow-derived mast cells. PMID: 17064958
  21. In mast cells lacking group V secretory PLA(2), the course of phosphorylation of ERK1/2 and of cPLA(2)alpha was markedly truncated. PMID: 17369491
  22. group v phospholipase A2 is a critical messenger enzyme in the development of airway hyperresponsiveness and regulation of cell migration during immunosensitization by a pathway that is independent of group IVa phospholipase A2 PMID: 17878379
  23. results demonstrate the critical role of cPLA2 for the duration of inflammation in collagen-induced arthritis PMID: 18825749
  24. role for syndecan-4 in mediating the uptake of LDL modified by group V secretory phospholipase A2, a process implicated in atherosclerotic lesion progression PMID: 19056705
  25. sPLA(2), either through pathways comprising Ras/Raf-1/MEK1/ERK1/2 or the classical PKC family, plays an essential role in Mtb-mediated ROS generation and inflammatory mediator release by microglial cells. PMID: 19115385
  26. gVPLA(2) is an inducible protein in pla2g5(+/+) mice but not in pla2g5(-/-) mice within 24 h after lipopolysaccharide treatment PMID: 19286925
  27. group V sPLA(2) regulates phagocytosis through major phagocytic receptors and contributes to the innate immune response against C. albicans by regulating phagocytosis and killing through a mechanism that is likely dependent on phagolysosome fusion PMID: 19342668

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed