Recombinant Mouse PGP9.5 Protein
Beta LifeScience
SKU/CAT #: BLA-10018P
Recombinant Mouse PGP9.5 Protein
Beta LifeScience
SKU/CAT #: BLA-10018P
Catalog No.: BLA-10018P
Product Overview
| Host Species | Mouse |
| Accession | Q9R0P9 |
| Synonym | Epididymis luminal protein 117 Epididymis secretory protein Li 53 HEL 117 HEL S 53 NDGOA Neuron cytoplasmic protein 9.5 OTTHUMP00000218137 OTTHUMP00000218139 OTTHUMP00000218140 OTTHUMP00000218141 Park 5 PARK5 PGP 9.5 PGP9.5 PGP95 Protein gene product 9.5 Ubiquitin C terminal esterase L1 Ubiquitin C terminal hydrolase Ubiquitin C terminal hydrolase L1 Ubiquitin carboxyl terminal esterase L1 Ubiquitin carboxyl terminal hydrolase isozyme L1 Ubiquitin carboxyl-terminal hydrolase isozyme L1 Ubiquitin thioesterase L1 Ubiquitin thiolesterase Ubiquitin thiolesterase L1 UCH-L1 UCHL1 UCHL1_HUMAN |
| Description | Recombinant Mouse PGP9.5 Protein was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMQLKPMEINPEMLNKVLAKLGVAGQWR FADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRKKQIEELKGQEVSP KVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPE DRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDG RMPFPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA |
| Molecular Weight | 27 kDa including tags |
| Purity | >90% SDS-PAGE.Purified using conventional chromatography techniques. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
