Recombinant Mouse Peroxiredoxin 6 Protein
Beta LifeScience
SKU/CAT #: BLA-10014P
Recombinant Mouse Peroxiredoxin 6 Protein
Beta LifeScience
SKU/CAT #: BLA-10014P
Catalog No.: BLA-10014P
Product Overview
| Host Species | Mouse |
| Accession | O08709 |
| Synonym | 1 Cys 1 Cys peroxiredoxin 1 Cys PRX 1 cysPrx 1-Cys peroxiredoxin 1-Cys PRX 24 kDa protein 9430088D19Rik AA690119 Acidic calcium independent phospholipase A2 Acidic calcium-independent phospholipase A2 aiPLA2 Antioxidant protein 2 AOP2 Aop2 rs3 Brp 12 Ciliary body glutathione peroxidase CP 3 EC 1.11.1.15 EC 1.11.1.7 EC 3.1.1. Epididymis secretory sperm binding protein Li 128m GPx HEL S 128m KIAA0106 Liver 2D page spot 40 Ltw4 Lvtw 4 MGC46173 mKIAA0106 Non selenium glutathione peroxidase Non-selenium glutathione peroxidase NSGPx ORF06 OTTHUMP00000032693 p29 Peroxiredoxin-6 Peroxiredoxin6 PHGPx Phospholipase A2 lysosomal PLA2 PRDX 6 Prdx5 PRDX6 Prdx6 rs3 PRDX6_HUMAN PRX Red blood cells page spot 12 Thiol specific antioxidant protein |
| Description | Recombinant Mouse Peroxiredoxin 6 Protein was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | HHHHHHGSGGSGPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSH PRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDIN AYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVF IFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKK GESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP |
| Molecular Weight | 26 kDa including tags |
| Purity | >99% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |
