Recombinant Mouse PDK1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10009P

Recombinant Mouse PDK1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10009P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession Q8BFP9
Synonym [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial HGNC:8809 Mitochondrial pyruvate dehydrogenase kinase isoenzyme 1 PDH kinase 1 Pdk1 PDK1_HUMAN Pyruvate dehydrogenase kinase isoform 1 Pyruvate dehydrogenase kinase, isoenzyme 1
Description Recombinant Mouse PDK1 Protein (His tag) was expressed in Baculovirus. It is a Full length protein
Source Baculovirus
AA Sequence ASASASGSGPASELGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSF MFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKD KSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQN VQYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEV IKDGYENARRLCDLYYVNSPELELEELNAKSPGQTIQVVYVPSHLYHMVF ELFKNAMRATMEHHADKGVYPPIQVHVTLGEEDLTVKMSDRGGGVPLRKI DRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSL EGYGTDAVIYIKALSTESVERLPVYNKAAWKHYKANHEADDWCVPSREPK DMTTFRSS
Molecular Weight 49 kDa including tags
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress.
Subcellular Location Mitochondrion matrix.
Protein Families PDK/BCKDK protein kinase family
Database References

Gene Functions References

  1. In Agrp Pdk1-/- female mice stature and femur length were shorter. Bone mineral density in the femur decreased, and bone formation was delayed. PMID: 28462077
  2. HIF-1alpha-PDK1-mediated metabolic changes occur in mild hypoxia, where mitochondrial cytochrome c oxidase activity is unimpaired, suggesting a mode of glycolytic reprogramming. PMID: 27189088
  3. The results demonstrate a novel role of PDK1 in AgRP neurons to counteract the high salt diet-induced hypertension by preventing hyperactivation of paraventricular nucleus nesfatin-1 neurons. PMID: 29705701
  4. Here, the authors show that loss of Fxn in the nervous system in mice also activates an iron/sphingolipid/PDK1/Mef2 pathway, indicating that the mechanism is evolutionarily conserved. PMID: 27901468
  5. PDK1 has broad effects in hematopoiesis and is a critical factor for engraftment of both hematopoietic stem cells and multipotent progenitors upon transplantation to recipient mice. PMID: 28182733
  6. PTEN is required for stabilization of planar cell packing in the neural plate and for the formation of stable apical-basal microtubule arrays, while PDPK1 is required for stabilization of apical junctions during epithelial morphogenesis. PMID: 26809587
  7. results thus reveal an essential role for the PDK1-Akt pathway in the regulation of a key step of neuronal migration. PMID: 27170189
  8. PDK1 plays a pivotal role in regulating cardiac function and tumor metastasis by interfering with microenvironment. PMID: 25601552
  9. These findings reveal that there are divergent roles of PDKs during oocyte maturation and indicate a new mechanism controlling meiotic structure. PMID: 25991547
  10. Our data suggest that two arms of the glucose metabolism synergistically regulate the differential activation of macrophages. Our findings also highlight the central role of PDK1 in this event via controlling glycolysis and glucose oxidation. PMID: 25964487
  11. PDHK1 is expressed in Th17 cells, but not Th1 cells, and at low levels in Tregs, and inhibition or knockdown of PDHK1 selectively suppressed Th17 cells and increased Tregs. PMID: 25437876
  12. The tyrosine phosphorylation enhances PDHK1 kinase activity by promoting ATP and PDC binding. PMID: 22195962
  13. Pdk1 enzyme is critical in conserving mitochondrial function by diverting metabolic intermediates to glycolysis PMID: 20160671

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed