Recombinant Mouse PDE7B Protein
Beta LifeScience
SKU/CAT #: BLA-10008P
Recombinant Mouse PDE7B Protein
Beta LifeScience
SKU/CAT #: BLA-10008P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9QXQ1 |
Synonym | bA472E5.1 cAMP specific 3 5 cyclic phosphodiesterase 7B cAMP specific 3'5' cyclic phosphodiesterase 7B High affinity cAMP specific 3 5 cyclic phosphodiesterase High affinity cAMP specific 3'5' cyclic phosphodiesterase MGC88256 OTTHUMP00000017267 PDE 7B PDE7B protein Phosphodiesterase 7B Phosphodiesterase7B RNPDE7B Rolipram insensitive phosphodiesterase type 7 |
Description | Recombinant Mouse PDE7B Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MLSKVGTWDFDIFLFDRLTNGNSLVTLLCHLFNSHGLIHHFKLDMVTLHR FLVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGL LAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRES RLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLEN VQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFEL EISPLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSTLSENMLSHLA HNKAQWKSLLSNQHRRRGSGQDLAGPAPETLEQTEGATP |
Molecular Weight | 65 kDa including tags |
Purity | >= 65% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific Activity: -‰¥240 pmol/min/µg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |