Name: Recombinant Mouse PD1 Protein (Fc Tag)
Brand: Beta LifeScience
SKU: BLA-10003P
Availability: InStock

Catalog No.: BLA-10003P

Host Species	Mouse
Accession	Q02242
Synonym	CD279 CD279 antigen hPD 1 hPD l hPD-1 hSLE1 PD 1 PD-1 PD1 PDCD 1 PDCD1 PDCD1_HUMAN Programmed cell death 1 Programmed cell death 1 protein Programmed cell death protein 1 Protein PD 1 Protein PD-1 SLEB2 Systemic lupus erythematosus susceptibility 2
Description	Recombinant Mouse PD1 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSN QTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCG AISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
Molecular Weight	43 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.