Recombinant Mouse PD1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10002P
Recombinant Mouse PD1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10002P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q02242 |
Synonym | CD279 CD279 antigen hPD 1 hPD l hPD-1 hSLE1 PD 1 PD-1 PD1 PDCD 1 PDCD1 PDCD1_HUMAN Programmed cell death 1 Programmed cell death 1 protein Programmed cell death protein 1 Protein PD 1 Protein PD-1 SLEB2 Systemic lupus erythematosus susceptibility 2 |
Description | Recombinant Mouse PD1 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | SGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRL SPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGI YLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ |
Molecular Weight | 44 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Immobilized Mouse PD-L1, Fc Tag at 5 μg/mL (100 μL/well) can bind Mouse PD-1, mouse IgG2a Fc tag with a linear range of 0.078-0.313 μg/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |