Recombinant Mouse PD1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10002P
Recombinant Mouse PD1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10002P
Catalog No.: BLA-10002P
Product Overview
| Host Species | Mouse |
| Accession | Q02242 |
| Synonym | CD279 CD279 antigen hPD 1 hPD l hPD-1 hSLE1 PD 1 PD-1 PD1 PDCD 1 PDCD1 PDCD1_HUMAN Programmed cell death 1 Programmed cell death 1 protein Programmed cell death protein 1 Protein PD 1 Protein PD-1 SLEB2 Systemic lupus erythematosus susceptibility 2 |
| Description | Recombinant Mouse PD1 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
| Source | HEK293 |
| AA Sequence | SGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRL SPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGI YLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ |
| Molecular Weight | 44 kDa including tags |
| Purity | >95% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | Immobilized Mouse PD-L1, Fc Tag at 5 μg/mL (100 μL/well) can bind Mouse PD-1, mouse IgG2a Fc tag with a linear range of 0.078-0.313 μg/mL. |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
