Recombinant Mouse PAI1 Protein

Beta LifeScience SKU/CAT #: BLA-9995P
Recombinant Mouse PAI1 Protein

Recombinant Mouse PAI1 Protein

Beta LifeScience SKU/CAT #: BLA-9995P
Catalog No.: BLA-9995P

Product Overview

Host Species Mouse
Accession P22777
Synonym Clade E Endothelial plasminogen activator inhibitor Nexin Nexin plasminogen activator inhibitor type 1 PAI PAI 1 PAI-1 PAI1_HUMAN PLANH1 Plasminogen activator inhibitor 1 Plasminogen activator inhibitor type 1 Serine (or cysteine) proteinase inhibitor Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 Serine proteinase inhibitor clade E member 1 serpin Serpin E1 Serpin peptidase inhibitor clade E Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 Serpine 1 SERPINE1
Description Recombinant Mouse PAI1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence LPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTT AGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAIFVQ RDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMIND LLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVP MMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDVHLSAL TNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFS ATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPT EMVIDRSFLFVVRHNPTETILFMGQVMEP
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity ab93068 is 80 (+/-) 5% active by uPA titration. The active fraction typically contains 70 percent active PAI1. Active concentration = ~2.0 mg/mL.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed