Recombinant Mouse PAI1 Protein
Beta LifeScience
SKU/CAT #: BLA-9995P

Recombinant Mouse PAI1 Protein
Beta LifeScience
SKU/CAT #: BLA-9995P
Catalog No.: BLA-9995P
Product Overview
Host Species | Mouse |
Accession | P22777 |
Synonym | Clade E Endothelial plasminogen activator inhibitor Nexin Nexin plasminogen activator inhibitor type 1 PAI PAI 1 PAI-1 PAI1_HUMAN PLANH1 Plasminogen activator inhibitor 1 Plasminogen activator inhibitor type 1 Serine (or cysteine) proteinase inhibitor Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 Serine proteinase inhibitor clade E member 1 serpin Serpin E1 Serpin peptidase inhibitor clade E Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1 Serpine 1 SERPINE1 |
Description | Recombinant Mouse PAI1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | LPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTT AGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAIFVQ RDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMIND LLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVP MMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDVHLSAL TNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFS ATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPT EMVIDRSFLFVVRHNPTETILFMGQVMEP |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | ab93068 is 80 (+/-) 5% active by uPA titration. The active fraction typically contains 70 percent active PAI1. Active concentration = ~2.0 mg/mL. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |