Recombinant Mouse Ogg1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9989P
Recombinant Mouse Ogg1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9989P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | O08760 |
Synonym | 8 hydroxyguanine DNA glycosylase 8 oxoguanine DNA glycosylase 8 oxoguanine DNA glycosylase 1 AP lyase DNA (apurinic or apyrimidinic site) lyase DNA apurinic or apyrimidinic site lyase DNA lyase DNA-(apurinic or apyrimidinic site) lyase HMMH HOGG 1 HOGG1 MMH MUTM N glycosylase Ogg 1 Ogg1 OGG1_HUMAN OGH 1 OGH1 |
Description | Recombinant Mouse Ogg1 Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMLFRSWLPSSMRHRTLSSSPALWASIP CPRSELRLDLVLASGQSFRWKEQSPAHWSGVLADQVWTLTQTEDQLYCTV YRGDDSQVSRPTLEELETLHKYFQLDVSLAQLYSHWASVDSHFQRVAQKF QGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVT YHGFPNLHALAGPEAETHLRKLGLGYRARYVRASAKAILEEQGGPAWLQQ LRVAPYEEAHKALCTLPGVGAKVADCICLMALDKPQAVPVDVHVWQIAHR DYGWHPKTSQAKGPSPLANKELGNFFRNLWGPYAGWAQAVLFSADLRQPS LSREPPAKRKKGSKRPEG |
Molecular Weight | 41 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |