Name: Recombinant Mouse OCM Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-9988P
Availability: InStock

Catalog No.: BLA-9988P

Host Species	Mouse
Accession	P51879
Synonym	Ocm OCMN OM onco ONCO_HUMAN Oncomodulin-1 Parvalbumin beta
Description	Recombinant Mouse OCM Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFI DNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGAD EFQEMVHS
Molecular Weight	28 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.