Recombinant Mouse Nicotinic Acetylcholine Receptor alpha 1/CHRNA1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9981P
Recombinant Mouse Nicotinic Acetylcholine Receptor alpha 1/CHRNA1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9981P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P04756 |
Synonym | Acetylcholine receptor subunit alpha ACHA_HUMAN AChR ACHRA ACHRD CHNRA Cholinergic receptor nicotinic alpha 1 subunit Cholinergic receptor nicotinic alpha polypeptide 1 Cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) Chrna1 CMS1A CMS1B CMS2A FCCMS Nicotinic cholinergic receptor alpha 1 SCCMS Schizophrenia neurophysiologic defect candidate |
Description | Recombinant Mouse Nicotinic Acetylcholine Receptor alpha 1/CHRNA1 Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIV TTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDF AIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWT YDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLD ITYHFVMQRL |
Molecular Weight | 41 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
Subcellular Location | Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. |
Protein Families | Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily |
Database References |
Gene Functions References
- A triad of residues aligning to Thr-152, Glu-209, and Lys-211 in Htr3, appear to be involved in side-chain interactions near binding sites in Htr3a (subunit alpha) and muscle-type Chrna1. Data suggest that mutating Htr3a triad to that of Chrna1 increases binding affinity of nicotine to Htr3a. (Htr3 = 5-hydroxytryptamine/serotonin receptor; Chrna1 = cholinergic receptor nicotinic alpha polypeptide 1) PMID: 29298898
- The results indicate that in the absence of the alpha1-nAChR subunit, clusters of nAChRs coupled to SK2 potassium channels as well as functional efferent synapses did form, showing that alpha1 is not necessary for these processes to take place. PMID: 27098031
- Findings suggest the possible role of controlling localised inflammatory response by parasympathetic cholinergic nerves through a1nAChRs of inflammation sites. PMID: 26778394
- This study demonstrates that genes coding for CHRNA1 subunits may contain variants associated with statin-induced ADRs. PMID: 22688219
- Chrna1 was co-purified with nicotinic acetylcholine receptor (AChR) in C2C12 myotubes. In addition, Stau1 was found to interact with Chrna1 mRNA, and knocking down of Stau1 by RNAi resulted in defective AChR clustering. PMID: 22884571
- These results suggest that in skeletal muscle cells, neural activity reduces the molar ratio of YB-1 relative to its binding AChR alpha mRNA, leading to an increase of ribosome binding to the mRNA, and thus activating translation. PMID: 21964286
- Chrna1 could be the first transcriptional target of atonal homolog 1 in the inner ear PMID: 17961150
- The nAChRalpha1 gene plays a significant role at the artery wall, and reducing its expression decreases aortic plaque development. PMID: 20810113
- These data identify caveolin-3 as a critical component of the signaling machinery that drives nicotinic acetylcholine receptor clustering and controls neuromuscular junction function. PMID: 19940021
- These two residues (and homologous sites in epsilon; subunit) are not involved in specific interactions with nicotinic agonist, and they affect activation of nicotinic receptor by shaping overall structure of agonist binding site. PMID: 12411516
- In murine muscle-type AChR alpha transmembrane 3 domain, tryptophan substitution at positions Phe-284, Ala-287, and Ile-290 produces a significant increase in normalized macroscopic response in channel gating, primarily the channel closing rate. PMID: 14705933
- the interaction between alpha AChR M1 and M2 domains plays a key role in channel gating PMID: 17028140
- Receptors with neutral side chains at position 89 function well, if side chain is less perturbing than amide of asparagine (nitro or keto groups allow function) or if a compensating backbone mutation is introduced to relieve unfavorable electrostatics. PMID: 17223685
- HDAC4 is a neural activity-regulated deacetylase and a key signaling component that relays neural activity to the muscle transcriptional machinery through Dach2, myogenin, and nAChR PMID: 17873280
- Data suggest that the alpha1 nicotinic acetylcholine receptor might play an important role in mechanotransduction of tensile stress loading on maxillofacial skeletal myocytes. PMID: 18163199
- In S269I, mutant the peak-current amplitude decreases along trains of nearly saturating ACh pulses delivered at physiologically relevant frequencies, consistent with enhanced entry into desensitization in congenital myasthenic syndrome. PMID: 19171769
- The local anaesthetics proadifen and adiphenine inhibit nicotinic receptors by different molecular mechanisms. PMID: 19422391
- In this mouse experiemntal myasthenia gravis study demonstrated that Acetylcholine receptor-alpha1 subunit expression was increase with varying disease severity. PMID: 19609914
- fibroblast nicotinic receptor alpha1 binds urokinase and promotes renal fibrosis PMID: 19690163