Recombinant Mouse MRP8 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9964P
Recombinant Mouse MRP8 Protein (His tag)

Recombinant Mouse MRP8 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9964P
Catalog No.: BLA-9964P

Product Overview

Host Species Mouse
Accession P27005
Synonym 60B8Ag AI323541 B8Ag BEE11 CAGA Calgranulin-A Calprotectin L1L subunit Calprotectin, included CFAG CGLA Chemotactic cytokine CP-10 CP-10 Cystic fibrosis antigen L1Ag Leukocyte L1 complex light chain MA387 MIF Migration inhibitory factor-related protein 8 MRP-8 Myeloid-related protein 8 Neutrophil cytosolic 7 kDa protein NIF p8 Pro-inflammatory S100 cytokine Protein S100-A8 S100 calcium binding protein A8 S100 calcium binding protein A8 (calgranulin A) S100 calcium-binding protein A8 S100A8 S100A8/S100A9 complex, included S10A8_HUMAN Urinary stone protein band A
Description Recombinant Mouse MRP8 Protein (His tag) was expressed in Yeast. It is a Full length protein
Source Yeast
AA Sequence PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINI ENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Molecular Weight 12 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed