Recombinant Mouse MRP8 Protein
Beta LifeScience
SKU/CAT #: BLA-9963P

Recombinant Mouse MRP8 Protein
Beta LifeScience
SKU/CAT #: BLA-9963P
Catalog No.: BLA-9963P
Product Overview
Host Species | Mouse |
Accession | P27005 |
Synonym | 60B8Ag AI323541 B8Ag BEE11 CAGA Calgranulin-A Calprotectin L1L subunit Calprotectin, included CFAG CGLA Chemotactic cytokine CP-10 CP-10 Cystic fibrosis antigen L1Ag Leukocyte L1 complex light chain MA387 MIF Migration inhibitory factor-related protein 8 MRP-8 Myeloid-related protein 8 Neutrophil cytosolic 7 kDa protein NIF p8 Pro-inflammatory S100 cytokine Protein S100-A8 S100 calcium binding protein A8 S100 calcium binding protein A8 (calgranulin A) S100 calcium-binding protein A8 S100A8 S100A8/S100A9 complex, included S10A8_HUMAN Urinary stone protein band A |
Description | Recombinant Mouse MRP8 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMPSELEKALSNLIDVYHNYSNIQGNHHALY KNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGV ASHKDSHKE |
Molecular Weight | 12 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |